Target Information

General Information of This Target

Target ID	PATR0EGDKN
Target Name	DNA topoisomerase 1 (TOP1)
Gene Name	TOP1
Gene ID	7150
Synonym	DNA topoisomerase I
Sequence	MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF Click to Show/Hide
Family	the type IB topoisomerase family
Function	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)- enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells. Involved in the circadian transcription of the core circadian clock component BMAL1 by altering the chromatin structure around the ROR response elements (ROREs) on the BMAL1 promoter. Click to Show/Hide
Uniprot Entry	TOP1_HUMAN
HGNC ID	HGNC:11986
KEGG ID	hsa:7150

Full List of The ADC Related to This Target

Approved

Click To Hide/Show 2 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Trastuzumab deruxtecan	Trastuzumab	ERBB2	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[1]
ADC Info	Sacituzumab govitecan	Sacituzumab	TACSTD2	Active metabolite of irinotecan SN38	CL2A	[2]

Phase 3

Click To Hide/Show 4 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Datopotamab deruxtecan	Datopotamab	TACSTD2	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[3]
ADC Info	Patritumab deruxtecan	Patritumab	ERBB3	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[4]
ADC Info	SHR-A1811	Trastuzumab	ERBB2	SHR9265	Mc-Gly-Gly-Phe-Gly	[5]
ADC Info	SKB-264	Sacituzumab	TACSTD2	KL610023	Pyrimidine-CL2A-carbonate	[6]

Phase 2

Click To Hide/Show 17 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Labetuzumab govitecan	Labetuzumab	CEACAM5	Active metabolite of irinotecan SN38	CL2A	[7]
ADC Info	Ifinatamab deruxtecan	Ifinatamab	CD276	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[8]
ADC Info	BL-B01D1	SI-B001	ERBB3; EGFR	Camptothecin analogue ED04	Mc-Gly-Gly-Phe-Gly	[9]
ADC Info	AZD-8205	INT016	VTCN1	Topoisomerase I inhibitor	Mal-PEG8-Val-Ala	[10]
ADC Info	DB-1303	Undisclosed	ERBB2	P1003	Mc-Gly-Gly-Phe-Gly	[11]
ADC Info	DB-1305	Undisclosed	TACSTD2	P1003	Mc-Gly-Gly-Phe-Gly	[12]
ADC Info	IBI-354	Undisclosed	ERBB2	DX-8951 derivative (DXd)	PODS-CHX-A"-DTPA	[13]
ADC Info	PRO-1160	Undisclosed	CD70	Exatecan	Cys-11 ADC linker	[14]
ADC Info	PRO-1184	Undisclosed	FOLR1	Exatecan	Cys-11 ADC linker	[15]
ADC Info	SHR-A1904	Undisclosed	CLDN18.2	SHR9265	Mc-Gly-Gly-Phe-Gly	[16]
ADC Info	SHR-A1921	Undisclosed	TACSTD2	SHR9265	Mc-Gly-Gly-Phe-Gly	[17]
ADC Info	AZD-5335	Undisclosed	FOLR1	Proprietary DNA topoisomerase I inhibitor	Undisclosed	[18]
ADC Info	ESG-401	Sacituzumab	TACSTD2	Active metabolite of irinotecan SN38	Undisclosed	[19]
ADC Info	FDA-022	Undisclosed	ERBB2	Topoisomerase I inhibitor	Undisclosed	[20]
ADC Info	MHB088C	Undisclosed	CD276	Proprietary DNA topoisomerase I inhibitor	Undisclosed	[21]
ADC Info	MHB036C	Undisclosed	TACSTD2	Topoisomerase I inhibitor	Undisclosed	[22]
ADC Info	CBX-12	Undisclosed	Undisclosed	Exatecan	Undisclosed	[23]

Phase 1

Click To Hide/Show 5 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	DS-6000	Undisclosed	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[24]
ADC Info	DS-6157a	Undisclosed	GPR20	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[25]
ADC Info	Epratuzumab-SN38	Epratuzumab	CD22	Active metabolite of irinotecan SN38	CL2A	[26]
ADC Info	TQB2102	Undisclosed	HER2 ECD2; HER2 ECD4	Topoisomerase I inhibitor	Enzyme-cleavable linker	[27]
ADC Info	BL-M11D1	Undisclosed	CD33	Camptothecin analogue ED04	Undisclosed	[28]

IND

Click To Hide/Show 2 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	9MW-2921	Undisclosed	TACSTD2	Topoisomerase I inhibitor	Undisclosed	[29]
ADC Info	7MW-3711	Undisclosed	CD276	Topoisomerase I inhibitor	Undisclosed	[30]

Clinical candidate

Click To Hide/Show 18 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	IMMU-140	IMMU-114	HLA-DRA	Active metabolite of irinotecan SN38	CL2A	[31]
ADC Info	A7R-ADC-SN38	Anti-IL7R mAb A7R	IL7R	Active metabolite of irinotecan SN38	Mal-PEG12-carbamate-PEG27	[32]
ADC Info	ZW-191	Humanized Anti-FOLR1 IgG1 mAb	FOLR1	ZD06519	Mc-Gly-Gly-Phe-Gly-AM	[33]
ADC Info	ZW-220	Fully humanized Anti-SLC34A2 IgG1 mAb	SLC34A2	ZD06519	Mc-Gly-Gly-Phe-Gly-AM	[34]
ADC Info	DpADC	Undisclosed	TACSTD2	Topo1 inhibitor+immune agonist	Undisclosed	[35]
ADC Info	HER2 targeted DEP conjugate	Trastuzumab	ERBB2	Active metabolite of irinotecan SN38	Undisclosed	[36]
ADC Info	DS-3939	Gatipotuzumab	MUC1	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[37]
ADC Info	SMP-190	Undisclosed	Undisclosed	DX-8951 derivative (DXd)	Unique hydrophilic Linker	[38]
ADC Info	PRO-1102	Trastuzumab	ERBB2	Exatecan	Cleavable hydrophilic linker	[39]
ADC Info	STRO-003	SP11285	ROR1	Exatecan	SC3417	[40]
ADC Info	CUSP06	Undisclosed	CDH6	Exatecan	Protease cleavable linker	[41]
ADC Info	HMBD-501	Undisclosed	ERBB3	Exatecan	Undisclosed	[42]
ADC Info	NV104	Undisclosed	CD276	Irinotecan	Undisclosed	[43]
ADC Info	NV103	Undisclosed	CD99	Irinotecan	Undisclosed	[44]
ADC Info	DAN-311	Undisclosed	ERBB2	Camptothecin	Undisclosed	[45]
ADC Info	DB-1311	Undisclosed	CD276	Proprietary DNA topoisomerase I inhibitor	Undisclosed	[46]
ADC Info	DB-1310	Undisclosed	ERBB3	Proprietary DNA topoisomerase I inhibitor	Maleimide tetrapeptide-based cleavable linker	[47]
ADC Info	AMB-101	Undisclosed	Undisclosed	Topoisomerase I inhibitor	Undisclosed	[48]

Investigative

Click To Hide/Show 149 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	CAC10-CPT-LB	Brentuximab	TNFRSF8	Methylenedioxy CPT2 (CPT2)	Mc-PEG4-Val-Lys-Gly	[49]
ADC Info	CAC10-CPT-LC	Brentuximab	TNFRSF8	Methylenedioxy CPT2 (CPT2)	Mc-PEG8-Val-Lys-Gly	[49]
ADC Info	H00-CPT-LC	Anti-CD30 mAb h00	TNFRSF8	Methylenedioxy CPT2 (CPT2)	Mc-PEG8-Val-Lys-Gly	[49]
ADC Info	CAC10-GT	Brentuximab	TNFRSF8	Active metabolite of irinotecan SN38	CL2A	[49]
ADC Info	Mil40-5	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mc-Val-Ala-PABC	[50]
ADC Info	Mil40-6	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mal-PEG2-Val-Ala-PABC	[50]
ADC Info	Mil40-7	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mal-PEG4-Val-Ala-PABC	[50]
ADC Info	Mil40-8	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mal-PEG8-Val-Ala-PABC	[50]
ADC Info	40H3-CL2A-SN38	Anti-EGFR mAb 40H3	EGFR	Active metabolite of irinotecan SN38	CL2A	[51]
ADC Info	40H3-Deruxtecan	Anti-EGFR mAb 40H3	EGFR	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[51]
ADC Info	Emab-CL2E-SN38	Epratuzumab	CD22	Active metabolite of irinotecan SN38	CL2E	[52]
ADC Info	N501-SN38	Anti-5T4 n501 (nanobody)	TPBG	Active metabolite of irinotecan SN38	CL2A	[53]
ADC Info	M603-SN38 DAR6	Anti-5T4 mAb m603	TPBG	Active metabolite of irinotecan SN38	CL2A	[53]
ADC Info	CAC10-CPT-LA	Brentuximab	TNFRSF8	Methylenedioxy CPT1 (CPT1)	Mc-PEG4-Val-Lys-Gly	[49]
ADC Info	H00-CPT-LA	Anti-CD30 mAb h00	TNFRSF8	Methylenedioxy CPT1 (CPT1)	Mc-PEG4-Val-Lys-Gly	[49]
ADC Info	H00-CPT-LB	Anti-CD30 mAb h00	TNFRSF8	Methylenedioxy CPT2 (CPT2)	Mc-PEG4-Val-Lys-Gly	[49]
ADC Info	H00-GT	Anti-CD30 mAb h00	TNFRSF8	Active metabolite of irinotecan SN38	CL2A	[54]
ADC Info	VL-DAB31-SN38	Rabbit derived VL single-domain Anti-ody	Undisclosed	Active metabolite of irinotecan SN38	Mal-Cyc-PEG3-DAB	[55]
ADC Info	ROS-responsive SN38 ADC	Rabbit derived VL single-domain Anti-ody	Undisclosed	Active metabolite of irinotecan SN38	Mal-Cyc-PEG3-DAB	[55]
ADC Info	HLL1-CL2A-SN38	Milatuzumab	CD74	Active metabolite of irinotecan SN38	CL2A	[56]
ADC Info	Mil40-11 (DAR=7.1)	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mc-PEG8-Val-Ala-PABC	[50]
ADC Info	Mil40-11 (DAR=3.8)	Mil40	ERBB2	Active metabolite of irinotecan SN38	Mc-PEG8-Val-Ala-PABC	[50]
ADC Info	M603-SN38 DAR8	Anti-5T4 mAb m603	TPBG	Active metabolite of irinotecan SN38	CL2A	[53]
ADC Info	M603-SN38 DAR4	Anti-5T4 mAb m603	TPBG	Active metabolite of irinotecan SN38	CL2A	[53]
ADC Info	HPAM4-CL2A-SN38	Anti-MUC1 mAb hPAM4	MUC1	Active metabolite of irinotecan SN38	CL2A	[57]
ADC Info	HA19-SN38 antibody-drug conjugate	Anti-CD19 mAb hA19	CD19	Active metabolite of irinotecan SN38	CL2A	[58]
ADC Info	Raludotatug deruxtecan	Raludotatug	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[59]
ADC Info	Tra-Exa-PSAR10	Trastuzumab	ERBB2	Exatecan	Mal-Exa-PSAR10	[60]
ADC Info	Tra-Exa-PSAR0	Trastuzumab	ERBB2	Exatecan	Mal-Exa-PSAR0	[60]
ADC Info	ZW-251	Humanized Anti-GPC3 IgG1 mAb	GPC3	ZD06519	Mc-Gly-Gly-Phe-Gly-AM	[61]
ADC Info	ADC1-2	Cofetuzumab	PTK7	ADC 1-2 payload	ADC 1-2 linker	[62]
ADC Info	ADC1-4	Cofetuzumab	PTK7	ADC 1-4 payload	ADC 1-4 linker	[62]
ADC Info	ADC1-11	Cofetuzumab	PTK7	ADC 1-11 payload	ADC 1-11 linker	[62]
ADC Info	ADC2-2	Trastuzumab	ERBB2	ADC 2-2 payload	ADC 2-2 linker	[62]
ADC Info	ADC2-4	Trastuzumab	ERBB2	ADC 2-4 payload	ADC 2-4 linker	[62]
ADC Info	ADC2-6-2	Trastuzumab	ERBB2	ADC 2-6-2 payload	ADC 2-6-2 linker	[62]
ADC Info	ADC2-7-2	Trastuzumab	ERBB2	ADC 2-7-2 payload	ADC 2-7-2 linker	[62]
ADC Info	ADC2-9-1	Trastuzumab	ERBB2	ADC 2-9-1 payload	ADC 2-9-1 linker	[62]
ADC Info	ADC2-9-2	Trastuzumab	ERBB2	ADC 2-9-2 payload	ADC 2-9-2 linker	[62]
ADC Info	ADC2-10	Trastuzumab	ERBB2	ADC 2-10 payload	ADC 2-10 linker	[62]
ADC Info	ADC2-11	Trastuzumab	ERBB2	ADC 2-11 payload	ADC 2-11 linker	[62]
ADC Info	ADC2-22	Trastuzumab	ERBB2	ADC 2-22 payload	ADC 2-22 linker	[62]
ADC Info	ADC2-23	Trastuzumab	ERBB2	ADC 2-23 payload	ADC 2-23 linker	[62]
ADC Info	ADC2-24	Trastuzumab	ERBB2	ADC 2-24 payload	ADC 2-24 linker	[62]
ADC Info	ADC2-25	Trastuzumab	ERBB2	ADC 2-25 payload	ADC 2-25 linker	[62]
ADC Info	ADC2-26	Trastuzumab	ERBB2	ADC 2-26 payload	ADC 2-26 linker	[62]
ADC Info	ADC2-27	Trastuzumab	ERBB2	ADC 2-27 payload	ADC 2-27 linker	[62]
ADC Info	ADC2-29	Trastuzumab	ERBB2	ADC 2-29 payload	ADC 2-29 linker	[62]
ADC Info	ADC2-30	Trastuzumab	ERBB2	ADC 2-30 payload	ADC 2-30 linker	[62]
ADC Info	ADC2-31	Trastuzumab	ERBB2	ADC 2-31 payload	ADC 2-31 linker	[62]
ADC Info	ADC2-32	Trastuzumab	ERBB2	ADC 2-32 payload	ADC 2-32 linker	[62]
ADC Info	ADC2-33	Trastuzumab	ERBB2	ADC 2-33 payload	ADC 2-33 linker	[62]
ADC Info	ADC2-34	Trastuzumab	ERBB2	ADC 2-34 payload	ADC 2-34 linker	[62]
ADC Info	ADC2-35	Trastuzumab	ERBB2	ADC 2-35 payload	ADC 2-35 linker	[62]
ADC Info	ADC2-36-1	Trastuzumab	ERBB2	ADC 2-36-1 payload	ADC 2-36-1 linker	[62]
ADC Info	ADC2-36-2	Trastuzumab	ERBB2	ADC 2-36-2 payload	ADC 2-36-2 linker	[62]
ADC Info	ADC2-37	Trastuzumab	ERBB2	ADC 2-37 payload	ADC 2-37 linker	[62]
ADC Info	ADC2-38	Trastuzumab	ERBB2	ADC 2-38 payload	ADC 2-38 linker	[62]
ADC Info	ADC2-39	Trastuzumab	ERBB2	ADC 2-39 payload	ADC 2-39 linker	[62]
ADC Info	ADC2-40	Trastuzumab	ERBB2	ADC 2-40 payload	ADC 2-40 linker	[62]
ADC Info	ADC2-41	Trastuzumab	ERBB2	ADC 2-41 payload	ADC 2-41 linker	[62]
ADC Info	ADC2-42	Trastuzumab	ERBB2	ADC 2-42 payload	ADC 2-42 linker	[62]
ADC Info	ADC2-42-RO	Trastuzumab	ERBB2	ADC 2-42-RO payload	ADC 2-42-RO linker	[62]
ADC Info	ADC2-43	Trastuzumab	ERBB2	ADC 2-43 payload	ADC 2-43 linker	[62]
ADC Info	ADC2-44	Trastuzumab	ERBB2	ADC 2-44 payload	ADC 2-44 linker	[62]
ADC Info	ADC2-45	Trastuzumab	ERBB2	ADC 2-45 payload	ADC 2-45 linker	[62]
ADC Info	ADC2-46	Trastuzumab	ERBB2	ADC 2-46 payload	ADC 2-46 linker	[62]
ADC Info	ADC2-47	Trastuzumab	ERBB2	ADC 2-47 payload	ADC 2-47 linker	[62]
ADC Info	ADC2-48	Trastuzumab	ERBB2	ADC 2-48 payload	ADC 2-48 linker	[62]
ADC Info	ADC2-49	Trastuzumab	ERBB2	ADC 2-49 payload	ADC 2-49 linker	[62]
ADC Info	ADC2-50	Trastuzumab	ERBB2	ADC 2-50 payload	ADC 2-50 linker	[62]
ADC Info	ADC2-51	Trastuzumab	ERBB2	ADC 2-51 payload	ADC 2-51 linker	[62]
ADC Info	ADC2-53	Trastuzumab	ERBB2	ADC 2-53 payload	ADC 2-53 linker	[62]
ADC Info	ADC2-54	Trastuzumab	ERBB2	ADC 2-54 payload	ADC 2-54 linker	[62]
ADC Info	ADC2-55	Trastuzumab	ERBB2	ADC 2-55 payload	ADC 2-55 linker	[62]
ADC Info	ADC2-56	Trastuzumab	ERBB2	ADC 2-56 payload	ADC 2-56 linker	[62]
ADC Info	ADC2-57	Trastuzumab	ERBB2	ADC 2-57 payload	ADC 2-57 linker	[62]
ADC Info	ADC2-58	Trastuzumab	ERBB2	ADC 2-58 payload	ADC 2-58 linker	[62]
ADC Info	ADC2-59	Trastuzumab	ERBB2	ADC 2-59 payload	ADC 2-59 linker	[62]
ADC Info	ADC2-60	Trastuzumab	ERBB2	ADC 2-60 payload	ADC 2-60 linker	[62]
ADC Info	ADC2-61	Trastuzumab	ERBB2	ADC 2-61 payload	ADC 2-61 linker	[62]
ADC Info	ADC-2-62-1	Trastuzumab	ERBB2	ADC 2-62-1 payload	ADC 2-62-1 linker	[62]
ADC Info	ADC-2-62-2	Trastuzumab	ERBB2	ADC 2-62-2 payload	ADC 2-62-2 linker	[62]
ADC Info	ADC-2-63-1	Trastuzumab	ERBB2	ADC 2-63-1 payload	ADC 2-63-1 linker	[62]
ADC Info	ADC-2-63-2	Trastuzumab	ERBB2	ADC 2-63-2 payload	ADC 2-63-2 linker	[62]
ADC Info	ADC-2-64-1	Trastuzumab	ERBB2	ADC 2-64-1 payload	ADC 2-64-1 linker	[62]
ADC Info	ADC-2-64-2	Trastuzumab	ERBB2	ADC 2-64-2 payload	ADC 2-64-2 linker	[62]
ADC Info	ADC-2-65-1	Trastuzumab	ERBB2	ADC 2-65-1 payload	ADC 2-65-1 linker	[62]
ADC Info	ADC-2-65-2	Trastuzumab	ERBB2	ADC 2-65-2 payload	ADC 2-65-2 linker	[62]
ADC Info	ADC3-1	Trastuzumab	ERBB2	ADC 3-1 payload	ADC 3-1 linker	[62]
ADC Info	ADC3-2	Trastuzumab	ERBB2	ADC 3-2 payload	ADC 3-2 linker	[62]
ADC Info	ADC3-3	Trastuzumab	ERBB2	ADC 3-3 payload	ADC 3-3 linker	[62]
ADC Info	ADC3-4	Trastuzumab	ERBB2	ADC 3-4 payload	ADC 3-4 linker	[62]
ADC Info	ADC3-5	Trastuzumab	ERBB2	ADC 3-5 payload	ADC 3-5 linker	[62]
ADC Info	ADC3-6	Patritumab	ERBB3	ADC 3-6 payload	ADC 3-6 linker	[62]
ADC Info	ADC3-7	Patritumab	ERBB3	ADC 3-7 payload	ADC 3-7 linker	[62]
ADC Info	ADC3-8	Patritumab	ERBB3	ADC 3-8 payload	ADC 3-8 linker	[62]
ADC Info	ADC3-9	Patritumab	ERBB3	ADC 3-9 payload	ADC 3-9 linker	[62]
ADC Info	ADC3-10	Patritumab	ERBB3	ADC 3-10 payload	ADC 3-10 linker	[62]
ADC Info	ADC3-11	Patritumab	ERBB3	ADC 3-11 payload	ADC 3-11 linker	[62]
ADC Info	ADC3-12	Patritumab	ERBB3	ADC 3-12 payload	ADC 3-12 linker	[62]
ADC Info	ADC3-13	Patritumab	ERBB3	ADC 3-13 payload	ADC 3-13 linker	[62]
ADC Info	ADC3-14	Patritumab	ERBB3	ADC 3-14 payload	ADC 3-14 linker	[62]
ADC Info	ADC3-15	Patritumab	ERBB3	ADC 3-15 payload	ADC 3-15 linker	[62]
ADC Info	ADC3-16	Patritumab	ERBB3	ADC 3-16 payload	ADC 3-16 linker	[62]
ADC Info	ADC3-17	Patritumab	ERBB3	ADC 3-17 payload	ADC 3-17 linker	[62]
ADC Info	ADC3-18	Patritumab	ERBB3	ADC 3-18 payload	ADC 3-18 linker	[62]
ADC Info	ADC3-19	Patritumab	ERBB3	ADC 3-19 payload	ADC 3-19 linker	[62]
ADC Info	ADC3-20	Patritumab	ERBB3	ADC 3-20 payload	ADC 3-20 linker	[62]
ADC Info	ADC-C2	Patritumab	ERBB3	ADC-C2 payload	ADC-C2 linker	[62]
ADC Info	ADC-C3	Patritumab	ERBB3	ADC-C3 payload	ADC-C3 linker	[62]
ADC Info	ADC-C4	Patritumab	ERBB3	ADC-C4 payload	ADC-C4 linker	[62]
ADC Info	ADC-C5	Patritumab	ERBB3	ADC-C5 payload	ADC-C5 linker	[62]
ADC Info	ADC1-1	Cofetuzumab	PTK7	ADC 1-1 payload	ADC 1-1 linker	[62]
ADC Info	ADC1-12	Cofetuzumab	PTK7	ADC 1-12 payload	ADC 1-12 linker	[62]
ADC Info	ADC2-A	Trastuzumab	ERBB2	ADC 2-A payload	ADC 2-A linker	[62]
ADC Info	ADC2-B	Trastuzumab	ERBB2	ADC 2-B payload	ADC 2-B linker	[62]
ADC Info	ADC2-12	Trastuzumab	ERBB2	ADC 2-12 payload	ADC 2-12 linker	[62]
ADC Info	ADC-C1	Patritumab	ERBB3	ADC-C1 payload	ADC-C1 linker	[62]
ADC Info	Sacituzumab-Deruxtecan	Sacituzumab	TACSTD2	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[63]
ADC Info	CAC10-DT	Brentuximab	TNFRSF8	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[49]
ADC Info	Lmab-CL2A-SN38	Labetuzumab	CEACAM5	Active metabolite of irinotecan SN38	CL2E	[52]
ADC Info	H00-DT	Anti-CD30 mAb h00	TNFRSF8	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[49]
ADC Info	Trastuzumab-L6	Trastuzumab	ERBB2	MF-6	Bridged PEG4-valine-alanine	[64]
ADC Info	AMT-562	Ab562	ERBB3	Exatecan	Mc-Val-Ala-PABC	[65]
ADC Info	Trastuzumab-T1000-exatecan	Trastuzumab	ERBB2	Exatecan	Undisclosed	[66]
ADC Info	cot-APTEDB-SN38	Anti-EDB Ab cot	VAMP8	Active metabolite of irinotecan SN38	Mal-PEG4-Ala	[67]
ADC Info	WO2022078260A1 ADC-1	Trastuzumab	ERBB2	Ln-D9	WO2022078260A1_ADC-1 linker	[68]
ADC Info	WO2022078260A1 ADC-2	Trastuzumab	ERBB2	Ln-D1	WO2022078260A1_ADC-2 linker	[68]
ADC Info	WO2022078260A1 ADC-3	Trastuzumab	ERBB2	Ln-D2	WO2022078260A1_ADC-3 linker	[68]
ADC Info	WO2022078260A1 ADC-4	Trastuzumab	ERBB2	Ln-D4	WO2022078260A1_ADC-4 linker	[68]
ADC Info	WO2022078260A1 ADC-5	Trastuzumab	ERBB2	Ln-D5	WO2022078260A1_ADC-5 linker	[68]
ADC Info	WO2022078260A1 ADC-6	Trastuzumab	ERBB2	Ln-D6	WO2022078260A1_ADC-6 linker	[68]
ADC Info	WO2022078260A1 ADC-7	Trastuzumab	ERBB2	Ln-D7	WO2022078260A1_ADC-7 linker	[68]
ADC Info	WO2022078260A1 ADC-8	Trastuzumab	ERBB2	Ln-D8	WO2022078260A1_ADC-8 linker	[68]
ADC Info	WO2022078260A1 ADC-9	Cetuximab	EGFR	Ln-D2	WO2022078260A1_ADC-9 linker	[68]
ADC Info	WO2022078260A1 ADC-10	Cetuximab	EGFR	Ln-D7	WO2022078260A1_ADC-10 linker	[68]
ADC Info	Epratuzumab-CL2E-SN-38	Epratuzumab	CD22	Active metabolite of irinotecan SN38	CL2E	[69]
ADC Info	Epratuzumab-SN-38	Epratuzumab	CD22	Active metabolite of irinotecan SN38	CL2A	[69]
ADC Info	Veltuzumab-SN-38	Veltuzumab	MS4A1	Active metabolite of irinotecan SN38	CL2A	[69]
ADC Info	Veltuzumab-CL2E-SN-38	Veltuzumab	MS4A1	Active metabolite of irinotecan SN38	CL2E	[69]
ADC Info	Labetuzumab-CL2E-SN-38	Labetuzumab	CEACAM5	Active metabolite of irinotecan SN38	CL2E	[69]
ADC Info	Labetuzumab-SN-38	Labetuzumab	CEACAM5	Active metabolite of irinotecan SN38	CL2A	[69]
ADC Info	Sacituzumab-SN-38	Sacituzumab	TACSTD2	Active metabolite of irinotecan SN38	CL2A	[69]
ADC Info	H01L02-DXd	Anti-CDH6 mAb H01L02	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[70]
ADC Info	H02L02-DXd	Anti-CDH6 mAb H02L02	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[70]
ADC Info	H02L03-DXd	Anti-CDH6 mAb H02L03	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[70]
ADC Info	H04L02-DXd	Anti-CDH6 mAb H04L02	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[70]
ADC Info	NOV0712-DXd	Anti-CDH6 mAb NOV0712	CDH6	DX-8951 derivative (DXd)	Mc-Gly-Gly-Phe-Gly	[70]

References

Ref 1	Trastuzumab deruxtecan versus trastuzumab emtansine in patients with HER2-positive metastatic breast cancer: updated results from DESTINY-Breast03, a randomised, open-label, phase 3 trial. Lancet. 2023 Jan 14;401(10371):105-117. doi: 10.1016/S0140-6736(22)02420-5.
Ref 2	FDA approves sacituzumab govitecan-hziy for HR-positive breast cancer; 3 Feb 2023.
Ref 3	Datopotamab Deruxtecan, a Novel TROP2-directed Antibody-drug Conjugate, Demonstrates Potent Antitumor Activity by Efficient Drug Delivery to Tumor Cells. Mol Cancer Ther. 2021 Dec;20(12):2329-2340.
Ref 4	Efficacy and Safety of Patritumab Deruxtecan (HER3-DXd) in EGFR Inhibitor-Resistant, EGFR-Mutated Non-Small Cell Lung Cancer. Cancer Discov. 2022 Jan;12(1):74-89.
Ref 5	SHR-A1811, a novel anti-HER2 ADC with superior bystander effect, optimal DAR and favorable safety profiles. Cancer Res (2023) 83 (8_Supplement): LB031.
Ref 6	Preclinical profiles of SKB264, a novel anti-TROP2 antibody conjugated to topoisomerase inhibitor, demonstrated promising antitumor efficacy compared to IMMU-132. Front Oncol. 2022 Dec 23;12:951589.
Ref 7	Antibody conjugates of 7-ethyl-10-hydroxycamptothecin (SN-38) for targeted cancer chemotherapy. J Med Chem. 2008 Nov 13;51(21):6916-26. doi: 10.1021/jm800719t. Epub 2008 Oct 22.
Ref 8	Ifinatamab deruxtecan (I-DXd), a novel B7-H3-targeting antibody-drug conjugate, demonstrates efficient payload delivery into tumor through target-dependent internalization. Cancer Res (2023) 83 (7_Supplement): 4891.
Ref 9	BL-B01D1, a novel EGFRHER3-targeting ADC, demonstrates robust anti-tumor efficacy in preclinical evaluation. Cancer Res (2023) 83 (7_Supplement): 2642.
Ref 10	Design and Preclinical Evaluation of a Novel B7-H4-Directed Antibody-Drug Conjugate, AZD8205, Alone and in Combination with the PARP1-Selective Inhibitor AZD5305. Clin Cancer Res. 2023 Mar 14;29(6):1086-1101.
Ref 11	Safety and efficacy of DB-1303 in patients with advanced/metastatic solid tumors: A multicenter, open-label, first-in-human, phase 1/2a study. Journal of Clinical Oncology 2023 41:16_suppl, 3023-3023.
Ref 12	First in human trial of DB1305 in patients with advanced malignant solid tumors. Cancer Res (2023) 83 (8_Supplement): CT248.
Ref 13	A First-in-human Study of IBI354 in Subjects With Locally Advanced Unresectable or Metastatic Solid Tumors; NCT05636215.
Ref 14	PRO1160, a novel CD70-directed antibody-drug conjugate, demonstrates robust anti-tumor activity in mouse models of renal cell carcinoma and non-Hodgkin lymphoma. Cancer Res (2022) 82 (12_Supplement): 1759.
Ref 15	PRO1184, a novel folate receptor alpha-directed antibody-drug conjugate, demonstrates robust anti-tumor activity in mouse carcinoma models. Cancer Res (2022) 82 (12_Supplement): 1085.
Ref 16	An Open-Label, Single-Arm, Multi-Center Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1904 in Patients With Advanced Pancreatic Cancer, NCT04928625
Ref 17	SHR-A1921, a novel TROP-2 ADC with an optimized design and well-balanced profile between efficacy and safety. Cancer Res (2023) 83 (8_Supplement): LB030.
Ref 18	First disclosure of AZD5335, a TOP1i-ADC targeting low and high FR-expressing ovarian cancer with superior preclinical activity vs FR-MTI ADC. Cancer Res (2023) 83 (8_Supplement): LB025.
Ref 19	Study of ESG401 in Adults With Solid Tumors; NCT04892342.
Ref 20	A Study of FDA022-BB05 in Subjects With Advanced Solid Malignant Tumors; NCT05564858.
Ref 21	Study of MHB088C in Participants With Advanced or Metastatic Solid Tumors; NCT05652855.
Ref 22	Study of MHB036C in Participants With Advanced or Metastatic Solid Tumors
Ref 23	TOP1-DNA Trapping by Exatecan and Combination Therapy with ATR Inhibitor. Mol Cancer Ther. 2022 Jul 5;21(7):1090-1102.
Ref 24	A Study of DS-6000a in Subjects With Advanced Renal Cell Carcinoma and Ovarian Tumors; NCT04707248.
Ref 25	A phase 1, multicenter, open-label, first-in-human study of DS-6157a in patients (pts) with advanced gastrointestinal stromal tumor (GIST). Journal of Clinical Oncology 2022 40:16_suppl, 11512-11512.
Ref 26	ADC review: basic information about Epratuzumab-SN-38.
Ref 27	Clinical trial of the TQB2102 injection in patients with advanced cancers; 2023
Ref 28	A study of BL-M11D1 in patients with relapsed/refractory acute myeloid leukemia.
Ref 29	Accelerating Development of Mabwell's ADC Plateform: Clinical Trial Application for an Innovative Drug (9MW2921) Accepted by NMPA; 5 Feb 2023.
Ref 30	Clinical Trial Application for 7MW3711 - an Innovative Drug Developed by Mabwell's ADC Platform, Accepted by NMPA.
Ref 31	IMMU-140, a Novel SN-38 Antibody-Drug Conjugate Targeting HLA-DR, Mediates Dual Cytotoxic Effects in Hematologic Cancers and Malignant Melanoma. Mol Cancer Ther. 2018 Jan;17(1):150-160. doi: 10.1158/1535-7163.MCT-17-0354. Epub 2017 Nov 13.
Ref 32	Immunoregulation by IL-7R-targeting antibody-drug conjugates: overcoming steroid-resistance in cancer and autoimmune disease. Sci Rep. 2017 Sep 6;7(1):10735. doi: 10.1038/s41598-017-11255-4.
Ref 33	ZW191, a novel FRa-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 2641.
Ref 34	ZW220, a novel NaPi2b-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 1533.
Ref 35	An innovative site-specific dual-payload antibody drug conjugate (dpADC) combining a novel Topo1 inhibitor and an immune agonist delivers a strong immunogenic cell death (ICD) and antitumor response in vitro and in vivo. Cancer Res (2023) 83 (7_Supplement): 2640.
Ref 36	HER2-targeted DEP SN-38 ADC outperforms in HER2+ human cancer model (ASX announcement); 2023
Ref 37	Expanded precision medicine capabilities for strengthening oncology drug development at Daiichi Sankyo; 2021
Ref 38	Xiling yuan pharmaceutical company product pipeline
Ref 39	The preclinical pharmacology of PRO1102, a novel exatecan-based HER2-directed antibody-drug conjugate with robust anti-tumor activity. Cancer Res (2022) 82 (12_Supplement): 1758.
Ref 40	STRO-003 is a novel ROR1-targeted ADC for breast and lung cancer. Journal for ImmunoTherapy of Cancer 2022;10:doi: 10.1136/jitc-2022-SITC2022.1191.
Ref 41	CUSP06/AMT-707, a new CDH6-targeting antibody-drug conjugate, demonstrates potent antitumor activity in preclinical models. Cancer Res (2023) 83 (7_Supplement): 6320.
Ref 42	HMBD-501 - a novel Fc engineered, exatecan-based next generation HER3 targeting antibody drug conjugate shows robust efficacy and tolerability in pre-clinical solid tumor models. Cancer Res (2023) 83 (7_Supplement): 2660.
Ref 43	Nanovalent pharmaceuticals product pipeline
Ref 44	ADC review NV103
Ref 45	An investigational next generation ADC (DAN-311) is highly effective in HER2-low breast cancer models. Cancer Res (2022) 82 (4_Supplement): P2-13-09.
Ref 46	Preclinical development of a B7-H3-targeting ADC with a novel DNA topoisomerase I inhibitor for solid tumors. Cancer Res (2023) 83 (7_Supplement): 2967.
Ref 47	DB-1310, a novel Her3 targeting antibody-drug conjugate, exhibits therapeutic efficacy for solid tumors. Cancer Res (2023) 83 (7_Supplement): 1884.
Ref 48	Introduction to basic information on ADC drug AMB-101
Ref 49	Development of Novel Antibody-Camptothecin Conjugates. Mol Cancer Ther. 2021 Feb;20(2):329-339.
Ref 50	Synthesis and evaluation of highly releasable and structurally stable antibody-SN-38-conjugates. Drug Deliv. 2021 Dec;28(1):2603-2617.
Ref 51	Antibody drug conjugates, targeting cancer-expressed EGFR, exhibit potent and specific antitumor activity. Biomed Pharmacother. 2023 Jan;157:114047.
Ref 52	Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34.
Ref 53	A highly stable human single-domain antibody-drug conjugate exhibits superior penetration and treatment of solid tumors. Mol Ther. 2022 Aug 3;30(8):2785-2799.
Ref 54	Modified taxols .6. preparation of water-soluble prodrugs of taxol. J Nat Prod. 1991;54(6):1607-1611.
Ref 55	Diazaborines Are a Versatile Platform to Develop ROS-Responsive Antibody Drug Conjugates*. Angew Chem Int Ed Engl. 2021 Dec 1;60(49):25914-25921. doi: 10.1002/anie.202109835. Epub 2021 Nov 5.
Ref 56	Optimal cleavable linker for antibody-SN-38 conjugates for cancer therapy: Impact of linker's stability on efficacy. Cancer Res (2012) 72 (8_Supplement): 2526.
Ref 57	Antibody-SN-38 immunoconjugates with a CL2A linker.
Ref 58	Introduction to basic information on ADC drug hA19-SN-38 antibody-drug conjugate - Immunomedics.
Ref 59	Daiichi-Sankyo showcases latest research towards creating new standards of care for patients with cancer with data at ASCO and EHA; 25 May 2023.
Ref 60	Exatecan Antibody Drug Conjugates Based on a Hydrophilic Polysarcosine Drug-Linker Platform. Pharmaceuticals (Basel). 2021 Mar 9;14(3):247. doi: 10.3390/ph14030247.
Ref 61	ZW251, a novel glypican-3-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 2658.
Ref 62	Antibody drug conjugates; 2023-07-06.
Ref 63	Antitumor compound, and preparation method therefor and use thereof; 2022-04-07.
Ref 64	A HER2-targeted antibody-novel DNA topoisomerase I inhibitor conjugate induces durable adaptive antitumor immunity by activating dendritic cells. MAbs. 2023 Jan-Dec;15(1):2220466. doi: 10.1080/19420862.2023.2220466.
Ref 65	AMT-562, a novel HER3-targeting antibody drug conjugate, demonstrates a potential to broaden therapeutic opportunities for HER3-expressing tumors. Mol Cancer Ther. 2023 Jun 11:MCT-23-0198. doi: 10.1158/1535-7163.MCT-23-0198. Online ahead of print.
Ref 66	Antibody-Exatecan Conjugates with a Novel Self-immolative Moiety Overcome Resistance in Colon and Lung Cancer. Cancer Discov. 2023 Apr 3;13(4):950-973. doi: 10.1158/2159-8290.CD-22-1368.
Ref 67	Antibody-Assisted Delivery of a Peptide-Drug Conjugate for Targeted Cancer Therapy. Mol Pharm. 2019 Jan 7;16(1):165-172. doi: 10.1021/acs.molpharmaceut.8b00924. Epub 2018 Dec 17.
Ref 68	Camptothecin derivative and ligand-drug conjugate thereof; 2022-04-21.
Ref 69	Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34. doi: 10.1158/1535-7163.MCT-11-0632. Epub 2011 Oct 28.
Ref 70	Anti-cdh6 antibody and anti-cdh6 antibody-drug conjugate.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.

Target Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)