Antigen ID	TAR0MWTFE
Antigen Name	Nectin-4 (NECTIN4)
Gene Name	NECTIN4
Gene ID	81607
Synonym	Ig superfamily receptor LNIR;Nectin cell adhesion molecule 4;Poliovirus receptor-related protein 4
Sequence	MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGE QVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQA DEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPS VTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHIL HVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALL FCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQ AMNHFVQENGTLRAKPTGNGIYINGRGHLV     Click to Show/Hide
Family	Nectin family
Function	Seems to be involved in cell adhesion through trans- homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.     Click to Show/Hide
Uniprot Entry	NECT4_HUMAN
HGNC ID	HGNC:19688
KEGG ID	hsa:81607

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2022057651A1 ADC-19	WO2022057651A1 ADC-19 payload	Undisclosed	WO2022057651A1 ADC-19 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2022057651A1 ADC-20	WO2022057651A1 ADC-20 payload	Undisclosed	WO2022057651A1 ADC-20 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2022057651A1 ADC-21	WO2022057651A1 ADC-21 payload	Undisclosed	WO2022057651A1 ADC-21 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Ab1-MMAE	Monomethyl auristatin E	Microtubule (MT)	NHS-VC-PAB	[2]
ADC Info	Abl-Linker-DM1	Mertansine DM1	Microtubule (MT)	Undisclosed	[3]
ADC Info	Abl-Linker-AF	CL202203715A1 AF	Undisclosed	Undisclosed	[3]
ADC Info	Abl-Linker-MMAF	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[3]
ADC Info	JP2025011033A Ab1	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab1 ADC	US20250000991A1 Ab1 ADC Payload	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]
ADC Info	Ab1-Linker-DM1	Undisclosed	Undisclosed	Undisclosed	[3]
ADC Info	Ab1-Linker-AF	Undisclosed	Undisclosed	Undisclosed	[3]
ADC Info	Ab1-Linker-MMAF	Undisclosed	Undisclosed	Undisclosed	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab1JP2025011033A A	Undisclosed	Undisclosed	Undisclosed	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2024107014A1 Ab2-Linker-AF 4.46	CL202203715A1 AF	Undisclosed	Undisclosed	[3]
ADC Info	JP2025011033A Ab2	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab2 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]
ADC Info	Ab2-Linker-AF 4.46	Undisclosed	Undisclosed	Undisclosed	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2024107014A1 Ab3-Linker-MMAF	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[3]
ADC Info	JP2025011033A Ab3	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab3 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]
ADC Info	Ab3-Linker-MMAF	Undisclosed	Undisclosed	Undisclosed	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab4	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab4 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab5	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab5 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab6	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab6 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab7	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab7 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	JP2025011033A Ab8	Undisclosed	Undisclosed	Undisclosed	[4]
ADC Info	US20250000991A1 Ab8 ADC	undisclosed	Undisclosed	US20250000991A1 Ab1 ADC Linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SBE303	TOP1 inhibitor	DNA topoisomerase 1 (TOP1)	Self-immolative OHPAS linker
ADC Info	Notiretatug rezetecan	SHR9265	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly
ADC Info	SKB410	TOP1 inhibitor	DNA topoisomerase 1 (TOP1)	Undisclosed
ADC Info	SYS6002	MMAE	Microtubule (MT)	NH2-PEG3-Val-Cit-PABC
ADC Info	SBT6290	TLR8 agonist	Toll-like receptor 8 (TLR8)	Undisclosed
ADC Info	BAT8007	Exatecan	DNA topoisomerase 1 (TOP1)	A cleavable but systemically stable linker
ADC Info	ADRX-0706	AP052	Microtubule (MT)	Adcentrx' proprietary linker
ADC Info	IPH45	Exatecan	DNA topoisomerase 1 (TOP1)	A cleavable hydrophilic linker
ADC Info	LY4101174	Exatecan	DNA topoisomerase 1 (TOP1)	maleimide-β-glucuronide poly-sarcosine linker

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LY4052031	LSN3889710	DNA topoisomerase 1 (TOP1)	A cleavable peptide linker

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ADC2204	Undisclosed	Undisclosed	Undisclosed	[6]
ADC Info	CN117159739A ADC7	undisclosed	Undisclosed	Undisclosed	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Bulumtatug fuvedotin	MMAE	Microtubule (MT)	IDM-Val-Cit-PBCA

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Enfortumab vedotin	MMAE	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	Araris ADC	Monomethyl auristatin E	Microtubule (MT)	Cathepsin B cleavable linker	[9]
ADC Info	WO2022057651A1 ADC-22	WO2022057651A1 ADC-22 payload	Undisclosed	WO2022057651A1 ADC-22 linker	[1]
ADC Info	Enfortumab-MMAE	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	huNb26/Nb26-Nbh-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SWY2001-Ab1-LND1002	Undisclosed	Undisclosed	Undisclosed	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Nectin-4-MMAE	Monomethyl auristatin E	Microtubule (MT)	IDconnect linker	[13]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	A-410	Undisclosed	Undisclosed	Undisclosed	[14]
ADC Info	JS114	Undisclosed	Undisclosed	Undisclosed	[15]
ADC Info	HLX-44	Undisclosed	Undisclosed	Undisclosed	[16]
ADC Info	NTX-1105	Undisclosed	Undisclosed	Undisclosed	[17]
ADC Info	Nectin-4 ADC (Jiangsu Hengrui)	Undisclosed	Undisclosed	Undisclosed	[18]
ADC Info	ETX-22	Undisclosed	Undisclosed	Undisclosed	[19]
ADC Info	N41mab-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[20]
ADC Info	BA-3361	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[21]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SM001	Exatecan	DNA topoisomerase 1 (TOP1)	Undisclosed	[22]
ADC Info	GLR1059	Undisclosed	Undisclosed	Undisclosed	[23]
ADC Info	anti-nectin-4 ADC	Undisclosed	Undisclosed	Undisclosed	[24]
ADC Info	WO2024043319A1 83	Undisclosed	Undisclosed	Undisclosed	[25]
ADC Info	CN118001423A ADC1	CN118001423A+ADC1+payload	Undisclosed	CN118001423A+ADC1+Linker	[26]
ADC Info	CN118001423A ADC2	CN118001423A+ADC2+payload	Undisclosed	CN118001423A+ADC1+Linker	[26]
ADC Info	CN118001423A ADC3	CN118001423A+ADC3+payload	Undisclosed	CN118001423A+ADC3+Linker	[26]
ADC Info	CN118001423A ADC4	CN118001423A+ADC4+payload	Undisclosed	CN118001423A+ADC3+Linker	[26]
ADC Info	CN118001423A ADC5	CN118001423A+ADC5+payload	Undisclosed	CN118001423A+ADC5+Linker	[26]

Ref 1	Anti-nectin-4 antibody, conjugate including same, and application thereof; 2022-03-24.
Ref 2	Discovery of a novel highly specific, fully human PSCA antibody and its application as an antibody-drug conjugate in prostate cancer
Ref 3	Anti-basal cell adhesion molecule antibody-drug conjugate
Ref 4	Nectin-4 antibodies and antibody-drug conjugates
Ref 5	Nectin-4 antibodies and antibody-drug conjugates
Ref 6	Introduction to basic information on ADC drug ADC2204
Ref 7	Antibody-drug conjugates, their preparation methods and applications
Ref 8	FDA Approval Summary: Enfortumab Vedotin for Locally Advanced or Metastatic Urothelial Carcinoma
Ref 9	Novel peptide linker-based nectin-4 targeting ADC shows improved tolerability with long-lasting anti-tumor efficacy at low doses. Cancer Res (2023) 83 (8_Supplement): LB221.
Ref 10	NECTIN4-targeted antibody-drug conjugate is a potential therapeutic option for extramammary Paget disease
Ref 11	A humanized trivalent Nectin-4-targeting nanobody drug conjugate displays potent antitumor activity in gastric cancer
Ref 12	Pharmaceutical compositions of recombinant humanized anti-Nectin-4 monoclonal antibody-MMAE conjugates
Ref 13	A novel and promising therapeutic approach for treating pancreatic cancer: Nectin-4-targeted antibody-drug conjugates alone or combined with autophagy inhibitors
Ref 14	Introduction to basic information on ADC drug A-410.
Ref 15	Junshi Biosciences biopharmaceutical company product pipeline
Ref 16	Introduction to basic information on ADC drug HLX-44.
Ref 17	Nectin therapeutics biotechnology company product pipeline
Ref 18	Introduction to basic information on Nectin-4 ADC (Jiangsu Hengrui).
Ref 19	Emergence therapeutics product pipeline
Ref 20	Nectin-4: a new prognostic biomarker for efficient therapeutic targeting of primary and metastatic triple-negative breast cancer. Ann Oncol. 2017 Apr 1;28(4):769-776. doi: 10.1093/annonc/mdw678.
Ref 21	NextGen conditionally active biologic (CAB) anti-Nectin-4-ADC with improved stability and safety. Cancer Res (2023) 83 (7_Supplement): 1541.
Ref 22	Development of an ELISA with acidification treatment for an antibody conjugate incorporating Exatecans
Ref 23	GLR1059, next-generation nectin-4-targeted ADC with a novel mechanism-of-action payload, demonstrated significantly potent anti-tumor efficacy and reduced toxicity in preclinical evaluation
Ref 24	Combination therapy with TB511 and anti-nectin-4 antibody drug conjugate in a human pancreatic cancer mouse model
Ref 25	Antibody-drug complexes
Ref 26	Hydrophilic anti-Nectin-4 antibody-drug conjugates and their preparation methods and uses