General Information of This Antibody (ID: ANTI0IOQUU)
Antibody Name
Ab2
Organization
ELI LILLY AND COMPANY
Synonyms
Ab2
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG
Antigen Name
Nectin-4 (NECTIN4)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTVGDTYYP
GSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCAREWNGMDVWGQGTTVTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFL
FPPKPKDTLMISRTPEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTVGDTYYP
GSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCAREWNGMDVWGQGTTVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
AASGFTFSSYDMH
    Click to Show/Hide
Heavy Chain CDR 2
AIGTVGDTY
    Click to Show/Hide
Heavy Chain CDR 3
AREWNGMDV
    Click to Show/Hide
Light Chain Sequence
DIVMTQSPDSLAVSLGERATINCKSSQSVLYNSNNKNYLAWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQFYTTPYSFGQGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIVMTQSPDSLAVSLGERATINCKSSQSVLYNSNNKNYLAWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQFYTTPYSFGQGTKVEIK
    Click to Show/Hide
Light Chain CDR 1
KSSQSVLYNSNNKNYLA
    Click to Show/Hide
Light Chain CDR 2
YWASTRES
    Click to Show/Hide
Light Chain CDR 3
QQFYTTPYS
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
0.05
nM
U266 (CD38-) cells
Antigen Expression Positive Tissue factor expression (TF+++/++; >350,000 tissue factor molecules/cell)
Antibody Function Ab2 bound to Normal Human Epidermal Keratinocytes
Antibody Antigen Binding Assay Normal Human Epidermal Keratinocytes cells were used. Antibody binding was quantified via flow cytometry and both the EC50 of the binding curves.
Antibody Activity Information 2 [1]
Half Maximal Effective Concentration (EC50)
0.06
nM
NCI-H1781 cells CVCL_1494 
Antigen Expression Positive Tissue factor expression (TF+++/++; >350,000 tissue factor molecules/cell)
Antibody Function Ab2 bound to NCI-H1781 cells
Antibody Antigen Binding Assay NCI-H1781 tumor cells representing lower endogenous expression. Antibody binding was quantified via flow cytometry and both the EC50 of the binding curves.
Antibody Activity Information 3 [1]
Half Maximal Effective Concentration (EC50)
0.19
nM
SUM190PT tumor cells CVCL_3423 
Antigen Expression Positive Tissue factor expression (TF+++/++; >350,000 tissue factor molecules/cell)
Antibody Function Ab2 bound to SUM190PT tumor cells
Antibody Antigen Binding Assay SUM190PT tumor cells representing high endogenous expression. Antibody binding was quantified via flow cytometry and both the EC50 of the binding curves.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
JP2025011033A Ab2 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Mean tumor colume&#177SEM
72.57&#17714.06 mm3
High nectin-4 expression (nectin-4 +++)
Method Description
Immune compromised female mice between 5-8 weeks of age with weight 18-20 grams were implanted unilaterally on the right flank with UM-UC-3 Nectin4 clone F7 cells with high nectin-4 expression, when tumors reached appproximately 150-250 mm^3, animals were matched by tumor volume into treatment or controls groups and dosing initiated (Day 0, n=8 per group). The test articles were given at a single dose (2 mg/kg) formulated with 5% dextrose. Tumors were measured biweekly until Day 40.

   Click to Show/Hide
In Vivo Model UMUC3 Nectin-4 clone F7 xenograft model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Mean tumor colume&#177SEM
124.95&#17710.32 mm3
Moderate nectin-4 expression (nectin-4++)
Method Description
Female NSG mice between 5-6 weeks of age were injected subcutaneously withMDA-MB-468 cells with moderate nectin-4 expression, when tumors reached appproximately 150-250 mm^3, animals were matched by tumor volume into treatment or controls groups and dosing initiated (Day 0, n=8 per group). The test articles were given at a single dose (2 mg/kg) formulated with 5% dextrose. Tumors were measured biweekly until Day 71.

   Click to Show/Hide
In Vivo Model MDAMB468 xenograft model
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.0473 nM
Positive nectin-4 expression (nectin-4+++/++)
Method Description
ADCs were tested in NCI H1781 cells, and were added at final working concentration from 200 nM, 1:4 serially diluted in culture medium for 5 days.
In Vitro Model Minimally invasive lung adenocarcinoma NCI-H1781 cells CVCL_1494
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.07 nM
Positive nectin-4 expression (nectin-4+++/++)
Method Description
ADCs were tested in T24-human nectin-4 clone 108 cells, and were added at final working concentration from 200 nM, 1:4 serially diluted in culture medium for 5 days.
In Vitro Model Bladder carcinoma T24-human nectin-4 clone cells CVCL_0554
US20250000991A1 Ab2 ADC [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.0836 nM
High Nectin-4 expression (Nectin-4 +++)
Method Description
Ab7 ADC was tested in T24 mScarlet clone 5 nectin-4 negative cells ;and with a DAR of 8
In Vitro Model Bladder carcinoma T24 mScarlet clone 5 nectin-4 negative cells CVCL_0554
References
Ref 1 Nectin-4 antibodies and antibody-drug conjugates
Ref 2 Nectin-4 antibodies and antibody-drug conjugates