Antibody Information
General Information of This Antibody (ID: ANI0LTVSQ)
| Antibody Name | Enfortumab |
|||||
|---|---|---|---|---|---|---|
| Organization | Astellas Pharma, Inc. |
|||||
| Indication | Neoplasms |
|||||
| Synonyms |
AGS-22C3
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Nectin-4 (NECTIN4) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVSYISSSSSTIYY
ADSVKGRFTISRDNAKNSLSLQMNSLRDEDTAVYYCARAYYYGMDVWGQGTTVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSVSASVGDRVTITCRASQGISGWLAWYQQKPGKAPKFLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPPTFGGGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Dissociation Constant (Kd)
|
1
|
pM
|
T-47D cells | CVCL_0553 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | High Nectin-4 expression (NECTIN4+++) | |||||
| Antibody Function | Confirm the effect of the drug conjugation with the anti-Nectin-4 Ab on binding activity to target. | |||||
| Antibody Antigen Binding Assay | Flow cytometry. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Enfortumab vedotin [Approved in 2019]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
73.30%
|
|||
| Patients Enrolled |
Histologically documented locally advanced/metastatic urothelial carcinoma (la/mUC) (including squamous differentiation and mixed cell types), an Eastern Cooperative Oncology Group performance status score of 0 or 1 (on a 5-point scale; higher scores indicate greater disability), and an investigator-assessed life expectancy of 3 or more months.
|
||||
| Administration Dosage |
1.25 mg/kg once daily on days 1 and 8 intravenously once daily in 3-week cycles.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04223856 | Clinical Status | Phase 3 | ||
| Clinical Description |
An open-label, randomized, controlled phase 3 study of enfortumab vedotin in combination with pembrolizumab versus chemotherapy alone in previously untreated locally advanced or metastatic urothelial cancer.
|
||||
| Primary Endpoint |
Safety: Seven patients (15.60%) experienced a serious TRAE, with no serious TRAE occurring more than once. TRAEs led to dose reductions in 14 (31.10%) patients and discontinuations in 11 (24.40%) patients and were not mutually exclusive. Peripheral sensory neuropathy was the most common TRAE leading to either dose reduction (six patients, 13.30%) or treatment discontinuation (four patients, 8.90%). No patients discontinued therapy because of a skin reaction or hyperglycemia. One patient (2.20%) died because of a TRAE (multiple organ dysfunction syndrome).
Click to Show/Hide
|
||||
| Other Endpoint |
The confirmed objective response rate after a median of nine cycles was 73.30% with a complete response rate of 15.60%. The median DOR and median OS were 25.60 months and 26.10 months, respectively.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
44%
|
High Nectin-4 expression (NECTIN4+++) | ||
| Patients Enrolled |
Locally advanced or metastatic urothelial carcinoma who were previously treated with platinum chemotherapy and antiPD-1/L1 therapy.
|
||||
| Administration Dosage |
1.25 mg/kg (intravenously on days 1, 8, and 15 of every 28-day cycle).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03219333 | Clinical Status | Phase 2 | ||
| Clinical Description |
A single-arm, open-label, multicenter study of enfortumab vedotin (ASG-22CE) for Treatment of patients with locally advanced or metastatic urothelial cancer who previously received immune checkpoint inhibitor (CPI) Therapy.
|
||||
| Primary Endpoint |
Confirmed objective response rate was 44.00% (95% CI, 35.10% to 53.20%), including 12.00% complete responses.
|
||||
| Other Endpoint |
Median duration of response was 7.60 months (range, 0.95 to 11.30 months).
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
51.68%
|
High Nectin-4 expression (NECTIN4+++) | ||
| Patients Enrolled |
Locally advanced or metastatic urothelial carcinoma previously treated with PD-1 or PD-L1 inhibitors; an Eastern Cooperative Oncology Group performance status score of 2 or less who were considered ineligible for cisplatin at enrolment and who had not received platinum-containing chemotherapy in the locally advanced or metastatic setting.
|
||||
| Administration Dosage |
Intravenously at a dose of 1.25 mg/kg on days 1, 8, and 15 of every 28-day cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03219333 | Clinical Status | Phase 2 | ||
| Clinical Description |
A single-arm, open-label, multicenter study of enfortumab vedotin (ASG-22CE) for treatment of patients with locally advanced or metastatic urothelial cancer who previously received immune checkpoint inhibitor (CPI) therapy.
|
||||
| Primary Endpoint |
The confirmed objective response rate was 51.68% (46 of 89 patients; 95% CI 41.00-62.00), with 18 (20.22%) of 89 patients achieving a complete response and 28 (31.46%) achieving a partial response.
|
||||
| Other Endpoint |
Duration of response, progression-free survival, objective response rate, overall survival, safety, and tolerability, plasma or serum pharmacokinetic parameters of enfortumab vedotin, MMAE, and total antibody, and incidence of antitherapeutic antibody to enfortumab vedotin.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
35.30%
|
Moderate Nectin-4 expression (NECTIN4++) | ||
| Patients Enrolled |
Histologically confirmed, locally advanced or metastatic transitional cell carcinoma of the urothelium (ie, cancer of the bladder, renal pelvis, ureter, or urethra), or UC with squamous differentiation or mixed cell types and an Eastern Cooperative Oncology Group (ECOG) performance status of 0 or 1.
|
||||
| Administration Dosage |
1.00 mg/kg (Arm A) or 1.25 mg/kg (Arm B) on Days 1, 8, and 15 of each 28-day cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03070990 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, randomized, phase 1 safety and pharmacokinetic study of enfortumab vedotin (ASG-22CE) in Japanese patients with locally advanced or metastatic urothelial carcinoma.
|
||||
| Primary Endpoint |
Safety/tolerability of EV, EV PK profile.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
43%
|
High Nectin-4 expression (NECTIN4+++) | ||
| Patients Enrolled |
Nectin-4positive solid tumors, including mUC, who progressed on 1 prior chemotherapy regimen or who were ineligible for cisplatin chemotherapy.
|
||||
| Administration Dosage |
Weight-based doses (0.50, 0.75, 1.00, and 1.25 mg/kg) through 30-minute infusion on days 1, 8, and 15 of a 28-day cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02091999 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of the safety and pharmacokinetics of escalating doses of ASG-22CE given as monotherapy in subjects with metastatic urothelial cancer and other malignant solid tumors that express nectin-4.
|
||||
| Primary Endpoint |
The determination of safety/tolerability, recommended phase II dose (RP2D), and pharmacokinetic (PK) profile of EV.
|
||||
| Other Endpoint |
Antitumor activity,including confirmed investigator-assessed ORR (RECIST version 1.1), duration of response (DoR), progression-free survival (PFS), and overall survival (OS).
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Histologically or cytologically confirmed urothelial carcinoma (including differentiation in squamous cells or in multiple cell types), radiologically documented metastatic or unresectable locally advanced disease at baseline, and an Eastern Cooperative Oncology Group (ECOG) performance-status score of 0 or 1 (scores range from 0 to 4, with higher scores indicating greater disability).
Click to Show/Hide
|
||||
| Administration Dosage |
Intravenous infusion over 30 minutes on days 1, 8, and 15 of a 28-day cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03474107 | Clinical Status | Phase 3 | ||
| Clinical Description |
An open-label, randomized phase 3 study to evaluate enfortumab vedotin vs chemotherapy in subjects with previously treated locally advanced or metastatic urothelial cancer (EV-301).
|
||||
| Primary Endpoint |
Overall survival was prolonged with enfortumab vedotin compared with chemotherapy (HR=0.70 [95% CI: 0.56-0.89];.
|
||||
| Other Endpoint |
Median overall survival: 12.88 vs 8.97 months, respectively). Progression-free survival was also longer in the enfortumab vedotin group compared with the chemotherapy group (HR=0.62 [95% CI: 0.51-0.75]; P<0.00001; median progression-free survival: 5.55 vs 3.71 months, respectively).
|
||||
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 30.80% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a bladder cancer cell with Nectin-4 high expression, dosed every 4 days at 0.4 mg/kg for 5 times.
|
||||
| In Vivo Model | Bladder cancer PDX model (PDX: AG-B1) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 33.90% | Moderate Nectin-4 expression (NECTIN4++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a pancreatic cancer cell with Nectin-4 moderate expression, dosed every 4 days at 1 mg/kg for 6 times.
|
||||
| In Vivo Model | Pancreatic cancer PDX model (PDX: AG-Panc4) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 45% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a breast cancer cell with Nectin-4 high expression, dosed every 4 days at 1 mg/kg for 6 times.
|
||||
| In Vivo Model | Breast cancer PDX model (PDX: AG-Br7) | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 68.80% | Moderate Nectin-4 expression (NECTIN4++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a pancreatic cancer cell with Nectin-4 moderate expression, dosed every 4 days at 3 mg/kg for 6 times.
|
||||
| In Vivo Model | Pancreatic cancer PDX model (PDX: AG-Panc4) | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 80.70% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a bladder cancer cell with Nectin-4 high expression, dosed every 4 days at 0.8 mg/kg for 5 times.
|
||||
| In Vivo Model | Bladder cancer PDX model (PDX: AG-B1) | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93.80% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a breast cancer cell with Nectin-4 high expression, dosed every 4 days at 3 mg/kg for 6 times.
|
||||
| In Vivo Model | Breast cancer PDX model (PDX: AG-Br7) | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.60% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in orthotopic PDX models of a breast cancer cell with Nectin-4 high expression, established in mammary fat pads of SCID mice, dosed single 10 mg/kg.
|
||||
| In Vivo Model | Breast cancer orthotopic PDX model (PDX: AG-Br7) | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.70% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in orthotopic PDX models of a breast cancer cell with Nectin-4 high expression, established in mammary fat pads of SCID mice, dosed twice 5 mg/kg.
|
||||
| In Vivo Model | Breast cancer orthotopic PDX model (PDX: AG-Br7) | ||||
| Experiment 9 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.70% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a bladder cancer cell with Nectin-4 high expression, single 4 mg/kg dose.
|
||||
| In Vivo Model | Bladder cancer PDX model (PDX: AG-B1) | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 26% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a lung adenocarcinoma cell with Nectin-4 high expression, dosed every 4 days at 1 mg/kg for 5 times.
|
||||
| In Vivo Model | NCI-H322M CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H322M cells | CVCL_1557 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 83.60% | High Nectin-4 expression (NECTIN4+++) | ||
| Method Description |
AGS-22M6E induces efficient tumor cell killing in PDX models of a lung adenocarcinoma cell with Nectin-4 high expression, dosed every 4 days at 3 mg/kg for 5 times.
|
||||
| In Vivo Model | NCI-H322M CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H322M cells | CVCL_1557 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.2 ng/mL
|
|||
| Method Description |
The inhibitory activity of AGS-22M6, AGS-22M6E ADC, and an isotype control ADC were added to various cancer cell lines in vitro and cell viability was measured after 5 days.
|
||||
| In Vitro Model | Prostate carcinoma | PC-3 cells | CVCL_0035 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.4 ng/mL
|
|||
| Method Description |
The inhibitory activity of AGS-22M6, AGS-22M6E ADC, and an isotype control ADC were added to various cancer cell lines in vitro and cell viability was measured after 5 days.
|
||||
| In Vitro Model | Prostate carcinoma | PC-3 cells | CVCL_0035 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.7 ng/mL
|
|||
| Method Description |
The inhibitory activity of AGS-22M6, AGS-22M6E ADC, and an isotype control ADC were added to various cancer cell lines in vitro and cell viability was measured after 5 days.
|
||||
| In Vitro Model | Prostate carcinoma | PC-3 cells | CVCL_0035 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
37.8 ng/mL
|
|||
| Method Description |
The inhibitory activity of AGS-22M6, AGS-22M6E ADC, and an isotype control ADC were added to various cancer cell lines in vitro and cell viability was measured after 5 days.
|
||||
| In Vitro Model | Invasive breast carcinoma | T-47D cells | CVCL_0553 | ||
WO2022057651A1 ADC-22 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive NECTIN4 expression (NECTIN4 +++/++) | ||
| Method Description |
Conjugates of the exemplary antibodies were tested using an established xenograft model implanted subcutaneous into SCID mice. Mice were randomized by body weight into treatment groups and treated once post cell inoculation with 10 mg/kg of one of the conjugates listed above or with PBS only.
|
||||
| In Vivo Model | NCI-H322M CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H322M cells | CVCL_1557 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
229.2 ng/mL
|
Positive NECTIN4 expression (NECTIN4 +++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Invasive breast carcinoma | T-47D cells | CVCL_0553 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.05 ug/mL
|
High NECTIN4 expression (NECTIN4 +++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Lung adenocarcinoma | A-549 cells | CVCL_0023 | ||
Enfortumab-MMAE [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [10] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
7.81۬.31 nM
|
|||
| Method Description |
Cells were seeded into 96-well plates (5000 cells/well) and incubated for 24 h at 37°C in 5% CO2. To investigate the effect of NECTIN4-targeted ADC, cells were incubated with medium containing enfortumab or enfortumab-MMAE conjugate. After 72 h of incubation, 10 uL of CCK-8 solution was added to each well and incubated for 3 h at 37°C. Then, absorbance at 450 nm was measured using a microplate reader (Bio-Rad Laboratories Inc.). The IC50 of the NECTIN4-targeted ADC was calculated using GraphPad Prism 7 software (GraphPad Software, San Diego, CA, USA).
Click to Show/Hide
|
||||
| In Vitro Model | Extramammary Paget disease | KS-EMPD-1 cells | CVCL_C4LP | ||
References
