Antibody Information
General Information of This Antibody
| Antibody ID | ANI0QYT005 |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Bulumtatug |
|||||
| Organization | Jiangsu Maiweikang New Drug R & D Co., Ltd.; Mabwell (Shanghai) Bioscience Co., Ltd. |
|||||
| Synonyms |
Bulumtatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Nectin-4 (NECTIN4) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLQESGPGLVKPSETLSLTCTVSGFSLIDYGVSWIRQPPGKGLEWIGVIWGGGKIYYN
SVLKSRVTISKDNSKSQVSLKLSSVTAADTAVYYCAKQGGLLFYAMDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMTQSPDSLAVSLGERATINCKSSQSLLNTYSQKNYLAWYQQKPGQPPKLLIYFASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQHYNTPFTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Bulumtatug fuvedotin [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
38.50%
|
|||
| Patients Enrolled |
Eligible patients (18-80 years, ECOG 0-1) must have advanced solid tumors (excluding sarcoma, with Nectin-4 testing in expansion cohorts), measurable disease (RECIST 1.1), and adequate organ function. Exclusions: recent anticancer therapies/surgeries (within 14-28 days), prior MMAE/nectin-4 ADCs, uncontrolled comorbidities (CNS metastases, diabetes, neuropathy ≥Grade 2), or CYP3A4/P-gp modifiers within 14 days. Contraception is mandatory during and for 6 months post-study
Click to Show/Hide
|
||||
| Administration Dosage |
All subjects will receive a single intravenous (IV) infusion of 9MW2821 once weekly for the first 3 weeks of every 4 week cycle (i.e., on Days 1, 8 and 15).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05216965 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase I/II Clinical Study of the Safety, Tolerability, Pharmacokinetics and Preliminary Antitumor Activity of 9MW2821 in Subjects With Advanced Malignant Solid Tumors
|
||||
| Primary Endpoint |
The primary safety outcome is adverse event incidence assessed until 28 days post-treatment, while the Phase 2 efficacy endpoint is confirmed objective response rate (ORR ≥28 days) evaluating complete/partial responses over 24 months.
|
||||
| Other Endpoint |
Key secondary endpoints include pharmacokinetics (Cmax, AUC, t½, CL) for TAb/ADC/MMAE, along with disease control rate, duration of response, time to response, progression-free survival, overall survival (all 24-month assessments), and anti-drug antibody monitoring.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Disease control rate (DCR) |
84.60%
|
|||
| Patients Enrolled |
Eligible patients (18-80 years, ECOG 0-1) must have advanced solid tumors (excluding sarcoma, with Nectin-4 testing in expansion cohorts), measurable disease (RECIST 1.1), and adequate organ function. Exclusions: recent anticancer therapies/surgeries (within 14-28 days), prior MMAE/nectin-4 ADCs, uncontrolled comorbidities (CNS metastases, diabetes, neuropathy ≥Grade 2), or CYP3A4/P-gp modifiers within 14 days. Contraception is mandatory during and for 6 months post-study
Click to Show/Hide
|
||||
| Administration Dosage |
All subjects will receive a single intravenous (IV) infusion of 9MW2821 once weekly for the first 3 weeks of every 4 week cycle (i.e., on Days 1, 8 and 15).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05216965 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase I/II Clinical Study of the Safety, Tolerability, Pharmacokinetics and Preliminary Antitumor Activity of 9MW2821 in Subjects With Advanced Malignant Solid Tumors
|
||||
| Primary Endpoint |
The primary safety outcome is adverse event incidence assessed until 28 days post-treatment, while the Phase 2 efficacy endpoint is confirmed objective response rate (ORR ≥28 days) evaluating complete/partial responses over 24 months.
|
||||
| Other Endpoint |
Key secondary endpoints include pharmacokinetics (Cmax, AUC, t½, CL) for TAb/ADC/MMAE, along with disease control rate, duration of response, time to response, progression-free survival, overall survival (all 24-month assessments), and anti-drug antibody monitoring.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) must have ECOG 0-1, measurable disease (RECIST v1.1), adequate organ function, and ≥12-week life expectancy. Key exclusions: Grade ≥2 treatment-related toxicities or peripheral neuropathy; active autoimmune diseases; recent anticancer therapies (chemotherapy/radiotherapy within 21 days or immunotherapy within 14 days); prior nectin-4 targeted ADC treatment; major surgery within 28 days; significant cardiac/cerebrovascular events within 6 months; or other active malignancies within 3 years. Contraception is required during and for 6 months post-treatment.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06492005 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Clinical Study of Efficacy and Safety of 9MW2821Monotherapy or Combined With PD-1 Inhibitor in Locally Advanced or Metastatic Triple-Negative Breast Cancer
|
||||
| Primary Endpoint |
The primary efficacy endpoint is objective response rate (ORR) according to RECIST v1.1, evaluated over a 24-month period in patients with locally advanced or metastatic triple-negative breast cancer.
|
||||
| Other Endpoint |
Secondary outcomes include duration of response (DoR), time to response (TTR), disease control rate (DCR), progression-free survival (PFS), and overall survival (OS) all assessed over 24 months. Pharmacokinetic analysis will measure Cmax, AUC, t1/2, and CL of TAb, ADC, and MMAE. Anti-drug antibody (ADA) incidence will be monitored throughout the study period.
Click to Show/Hide
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible patients must have ECOG 0-1, ≥12-week life expectancy, measurable disease (RECIST v1.1), and ≤2 prior systemic therapies (including platinum-based chemo ± bevacizumab). Exclusions: non-HPV-associated histologies, recent anticancer treatments (chemotherapy/radiation within 21 days; investigational drugs within 28 days), Grade ≥2 toxicity, uncontrolled comorbidities (HbA1c ≥8%, active infections, CNS metastases), major surgery within 28 days, or prior nectin-4/MMAE-based ADCs. Contraception is required during and for 6 months post-study.
Click to Show/Hide
|
||||
| Administration Dosage |
1.25mg/kg of 9MW2821 by intravenous infusion on days 1, 8 and 15 of every 28-day cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06692166 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Randomized, Open-label, Phase 3 Study to Evaluate 9MW2821 vs Treatment of Physician's Choice in Subjects With Recurrent or Metastatic Cervical Cancer Who Progressed on or After Platinum-based Chemotherapy
|
||||
| Primary Endpoint |
The primary endpoint is overall survival (OS), defined as the time from randomization to death from any cause, assessed over a 3-year study period in female patients (18-75 years) with recurrent/metastatic cervical cancer.
|
||||
| Other Endpoint |
Secondary efficacy endpoints include objective response rate (ORR), disease control rate (DCR), progression-free survival (PFS), duration of response (DoR), and time to response (TTR), all investigator-assessed per RECIST v1.1 over 3 years. Safety endpoints cover adverse event incidence and anti-drug antibody (ADA) development.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible patients (18-80 years, ECOG 0-1) must have advanced solid tumors (Phase Ia) or metastatic UC (Phase Ib), prior ICI/GC/GP therapy exposure, measurable disease (RECIST 1.1), adequate organ function, and provide tumor samples. Exclusions: recent anticancer therapies/surgeries (14-28 days), Grade ≥2 toxicity/neuropathy, MMAE-ADC treatment, uncontrolled comorbidities (CNS metastases, diabetes, cardiovascular disease), or strong CYP3A4/P-gp modifiers within 14 days. Contraception is mandatory during and 6 months post-study.
Click to Show/Hide
|
||||
| Administration Dosage |
All subjects will receive a single intravenous (IV) infusion of 9MW2821 once weekly for the first 3 weeks of every 4 week cycle (i.e., on Days 1, 8 and 15).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05773937 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Clinical Study of the Safety, Tolerability, Pharmacokinetics and Preliminary Antitumor Activity of 9MW2821 in Advanced Malignant Solid Tumors
|
||||
| Primary Endpoint |
The primary safety endpoint evaluates adverse event incidence monitored up to 28 days after the last dose administration.
|
||||
| Other Endpoint |
Key secondary endpoints include PK parameters (Cmax, AUC, t1/2, CL for TAb/ADC/MMAE) and efficacy measures (ORR, DCR, DoR, TTR, PFS, OS) over 24 months, alongside anti-drug antibody (ADA) incidence assessment.
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible participants (18-80 years, ECOG 0-1) must have histologically confirmed locally advanced/metastatic urothelial cancer, prior standard therapy (or treatment-naïve), measurable lesions (RECIST 1.1), adequate organ function, and tumor tissue availability. Exclusions encompass recent anticancer treatments (within 21 days), prior MMAE-ADC/PD- (L)1 therapy, significant treatment-related toxicity (≥Grade 2), uncontrolled comorbidities (CNS metastases, infections, diabetes), major surgery (within 28 days), strong CYP3A4/P-gp modifiers (14 days), active corneal risks, or conditions posing significant safety concerns. Contraception is required during and for 6 months post-study.
Click to Show/Hide
|
||||
| Administration Dosage |
1.0/1.25/1.5 mg/kg, intravenous (IV) infusion every cycle until disease progression or intolerable toxicity, etc.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06079112 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase Ib/II, Open-label, Single Arm, Multicenter Clinical Study to Evaluate the Safety and Efficacy of 9MW2821 Combined With Toripalimab Injection in Subjects With Local Advanced or Metastatic Urothelial Cancer
|
||||
| Primary Endpoint |
The primary safety endpoints include incidence rates of adverse events (AEs) and serious adverse events (SAEs), monitored continuously throughout the study period of up to 24 months.
|
||||
| Other Endpoint |
The key efficacy assessments consist of Objective Response Rate (ORR), Duration of Response (DOR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated over a 24-month timeframe; additional PK parameters (9MW2821 concentration) and immunogenicity (ADA) data will be collected for up to 12 months.
Click to Show/Hide
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible subjects (18-75 years, ECOG 0-1) must have locally advanced/metastatic urothelial cancer (platinum/PD- (L)1-refractory), measurable disease (RECIST 1.1), and adequate organ function. Exclusions: recent anticancer therapies (21 days), prior nectin-4/MMAE-ADC treatment, major surgery (28 days), Grade ≥2 toxicity/neuropathy, uncontrolled comorbidities (CNS metastases, HbA1c ≥8%, cardiac/cerebrovascular disease within 6 months), strong CYP3A4 modifiers (14 days), active infections, or conditions posing safety risks. Contraception is mandatory during and post-study (6 months).
Click to Show/Hide
|
||||
| Administration Dosage |
1.25mg/kg of 9MW2821 by intravenous infusion on days 1, 8 and 15 of every 28-day cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06196736 | Clinical Status | PHASE3 | ||
| Clinical Description |
An Open-label, Randomized Phase 3 Study to Evaluate 9MW2821 vs Investigator's Choice of Chemotherapy in Subjects With Locally Advanced or Metastatic Urothelial Cancer Who Have Previously Received PD- (L)1 Inhibitor and Platinum-containing Chemotherapy
|
||||
| Primary Endpoint |
Primary efficacy endpoints include Progression-Free Survival (PFS) and Overall Survival (OS), assessed via Blinded Independent Central Review (BICR) over 3 years, measuring time from randomization to disease progression or death (PFS) and time until death from any cause (OS).
|
||||
| Other Endpoint |
Secondary endpoints evaluated over 3 years encompass Objective Response Rate (ORR), Duration of Response (DOR), Time to Response (TTR), Disease Control Rate (DCR) per BICR/investigator, plus investigator-assessed PFS, alongside safety metrics (AE/ADA incidence) and quality-of-life measures (EORTC QLQ-C30, EQ-5D-5L VAS changes from baseline).
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible participants (≥18 years) must have high-risk NMIBC (non-muscle invasive, BCG/gemcitabine-refractory) post-TURBT (within 6 weeks), ECOG 0-1, and adequate organ function. Exclusions: prior muscle-invasive/metastatic disease, recent anticancer therapies (3 weeks), unresolved toxicity (>Grade 1), active infections, cardiovascular events (6 months), Nectin-4/MMAE-ADC exposure, or positive HBV/HCV/HIV serology. Contraception is mandatory during and for 180 days post-treatment.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06551233 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Clinical Study on the Safety and Efficacy of 9MW2821 in Patients With High-risk Non-muscle-invasive Bladder Cancer (NMIBC) That Have Previously Failed to Intravesical Therapy
|
||||
| Primary Endpoint |
The study will evaluate safety and tolerability over 12 months by assessing AE/SAE incidence while determining the Recommended Phase 2 Dose (RP2D) and Maximum Tolerated Dose (MTD) to establish safe dosing parameters.
|
||||
| Other Endpoint |
Efficacy assessments include 12-month Disease-Free Survival (DFS) rate, Duration of Complete Response (DoR), CR rates at 3/6/12 months, long-term DFS (up to 20 months), time to/proportion of radical cystectomy, and biomarker analysis (Nectin-4 expression).
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible participants (18-80 years, ECOG 0-1) must have untreated locally advanced/metastatic urothelial cancer (RECIST v1.1-measurable, cisplatin/carboplatin-suitable), adequate organ function, and accessible tumor tissue. Exclusions: prior malignancies (3 years), autoimmune/cardiovascular conditions (6 months), recent therapies (surgery/radiotherapy/CYP3A4 modulators), Grade ≥2 residual toxicity (excluding alopecia), active infections, Nectin-4/MMAE-ADC or checkpoint inhibitor exposure, uncontrolled CNS metastases, HBV/HCV/HIV coinfection, drug allergies, or high-risk ocular/neurological conditions. Contraception and protocol compliance are mandatory.
Click to Show/Hide
|
||||
| Administration Dosage |
9MW2821, 1.25mg/kg, intravenous (IV) infusion
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06592326 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Randomized, Controlled, Open-label, Multicenter Phase 3 Clinical Study of 9MW2821 in Combination With Toripalimab Versus Standard Chemotherapy in First-line Locally Advanced or Metastatic Urothelial Cancer
|
||||
| Primary Endpoint |
The primary endpoints include Blinded Independent Central Review-assessed Progression-Free Survival (BICR-PFS) and Overall Survival (OS), both evaluated over a 50-month timeframe.
|
||||
| Other Endpoint |
Secondary outcomes comprise Objective Response Rate (ORR), Disease Control Rate (DCR), Duration of Response (DoR), investigator-assessed PFS, safety metrics (AE/SAE), and immunogenicity (Anti-Drug Antibodies against 9MW2821), all monitored for up to 50 months.
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible patients (18-80 years, ECOG 0-1) must have untreated, histologically confirmed inoperable locally advanced/metastatic urothelial carcinoma (>50% urothelial differentiation) with ≥1 measurable lesion (RECIST v1.1). Key exclusions: other malignancies (3 years), active autoimmune disease requiring immunosuppressants, recent major cardiovascular/thromboembolic events (6 months), prior PD-1/PD-L1/CTLA-4/Nectin-4/MMAE-ADC therapy, uncontrolled infections, untreated CNS metastases, positive HBV/HCV/HIV serology, or drug allergies. Contraception and protocol adherence are mandatory.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06823427 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Randomized Phase II Trial to Evaluate 9MW2821 in Combination With Toripalimab Compared With 9MW2821 Monotherapy for the 1st Line Treatment of Locally Advanced or Metastatic Urothelial Carcinoma
|
||||
| Primary Endpoint |
The primary endpoint is Objective Response Rate (ORR) assessed by Blinded Independent Central Review (BICR) over a 3-year period.
|
||||
| Other Endpoint |
Secondary efficacy assessments include Overall Survival (OS), Progression-Free Survival (PFS), Duration of Response (DoR), Disease Control Rate (DCR), and ORR (investigator- and BICR-assessed). Safety monitoring covers treatment-emergent and -related adverse events (CTCAE v5.0), serious adverse events, and vital/lab abnormalities. Immunogenicity analysis measures ADA/NAb incidence, rates, and titers over 3 years.
Click to Show/Hide
|
||||
References
