General Information of This Antigen
Antigen ID
TAR0OVWVF
Antigen Name
Myeloid cell surface antigen CD33 (CD33)
Gene Name
CD33
Gene ID
945
Synonym
SIGLEC3; Sialic acid-binding Ig-like lectin 3;gp67;CD_antigen=CD33
Sequence
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ

    Click to Show/Hide
Family
Immunoglobulin family
Function
Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP- 2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K.

    Click to Show/Hide
Uniprot Entry
CD33_HUMAN
HGNC ID
HGNC:1659
KEGG ID
hsa:945
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
A recombinant humanized anti-CD33 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
DXC-007
Tubulysin B analog Tub255
Microtubule (MT)
Undisclosed
Anti-CD3 single-chain Fv
ADC Info ADC Name Payload Target Linker Ref
DT390 anti-CD3sFv immunotoxin
DT390
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[1]
Anti-CD33 AB1
ADC Info ADC Name Payload Target Linker Ref
Anti-CD33 AB1 Compound (Ia)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ia) linker
[2]
Anti-CD33 AB1 Compound (Ib)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ib) linker
[2]
Anti-CD33 AB1 Compound (Ic)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ic) linker
[2]
Anti-CD33 AB1 Compound (Id)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Id) linker
[2]
Anti-CD33 AB1 Compound (Ie)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ie) linker
[2]
Anti-CD33 AB1 Compound (If)
NeoDegrader P6
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (If) linker
[2]
Anti-CD33 AB1 Compound (Ig)
NeoDegrader P2
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ig) linker
[2]
Anti-CD33 AB1 Compound (Ih)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ih) linker
[2]
Anti-CD33 AB1 Compound (Ii)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ii) linker
[2]
Anti-CD33 AB1 Compound (Ij)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ij) linker
[2]
Anti-CD33 AB1 Compound (Ik)
NeoDegrader P14
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Ik) linker
[2]
Anti-CD33 AB1 Compound (Il)
NeoDegrader P14
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Il) linker
[2]
Anti-CD33 AB1 Compound (Im)
NeoDegrader P14
Protein cereblon (CRBN)
Anti-CD33 AB1 Compound (Im) linker
[2]
Anti-CD33 Anti-ody 11A1
ADC Info ADC Name Payload Target Linker Ref
CD33-CPI dimer ADC
Bicyclopentyl-seco-CBI-dimer
Human Deoxyribonucleic acid (hDNA)
AcLys-Val-Cit-PABC-DMAE
[3]
Anti-CD33 mAb 15G15.33
ADC Info ADC Name Payload Target Linker Ref
CD33 PNU ADC2-2
CD33 PNU ADC2-2 payload
Undisclosed
CD33 PNU ADC2-2 linker
[4]
CD33 PNU ADC3-2
CD33 PNU ADC3-2 payload
Undisclosed
CD33 PNU ADC3-2 linker
[4]
CD33 PNU ADC4-2
CD33 PNU ADC4-2 payload
Undisclosed
CD33 PNU ADC4-2 linker
[4]
CD33-PNU-LD1
CD33-PNU-LD1 payload
Undisclosed
CD33-PNU-LD1 linker
[4]
CD33-PNU-LD5
CD33-PNU-LD5 payload
Undisclosed
CD33-PNU-LD5 linker
[4]
CD33-PNU-LD6
CD33-PNU-LD6 payload
Undisclosed
CD33-PNU-LD6 linker
[4]
CD33-PNU-LD7
CD33-PNU-LD7 payload
Undisclosed
CD33-PNU-LD7 linker
[4]
Anti-CD33 mAb humanized 2H12
ADC Info ADC Name Payload Target Linker Ref
h2H12-Compound 1
h2H12-compound 1 payload
Undisclosed
h2H12-compound 1 linker
[5]
h2H12-Compound 2
h2H12-compound 2 payload
Undisclosed
h2H12-compound 2 linker
[5]
h2H12-Compound 3
h2H12-compound 3 payload
Undisclosed
h2H12-compound 3 linker
[5]
Anti-CD33 mAb huMy9-6
ADC Info ADC Name Payload Target Linker Ref
AVE-9633
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[6]
Anti-CD33 mAb murine 2H12
ADC Info ADC Name Payload Target Linker Ref
m2H12-Compound 1
m2H12-compound 1 payload
Undisclosed
m2H12-compound 1 linker
[5]
m2H12-Compound 2
m2H12-compound 2 payload
Undisclosed
m2H12-compound 2 linker
[5]
m2H12-Compound 3
m2H12-compound 3 payload
Undisclosed
m2H12-compound 3 linker
[5]
Anti-CD33AB
ADC Info ADC Name Payload Target Linker Ref
Anti-CD33AB-Compound (Ia)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33AB-Compound (Ia) linker
[7]
Anti-CD33AB-Compound (Ib)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33AB-Compound (Ib) linker
[7]
Anti-CD33AB-Compound (Ic)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33AB-Compound (Ic) linker
[7]
Anti-CD33AB-Compound (Ie)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33AB-Compound (Ie) linker
[7]
Anti-CD33AB-Compound (Ih)
NeoDegrader P1
Protein cereblon (CRBN)
Anti-CD33AB-Compound (Ih) linker
[7]
CD33-A Anti-ody
ADC Info ADC Name Payload Target Linker Ref
CD33-A Antibody-Compound (Ie)
CD33-A Antibody-Compound (Ie) payload
Undisclosed
CD33-A Antibody-Compound (Ie) linker
[8]
CD33-A Antibody-Compound (Ii)
CD33-A Antibody-Compound (Ii) payload
Undisclosed
CD33-A Antibody-Compound (Ii) linker
[8]
CD33-A Antibody-Compound (X)
CD33-A Antibody-Compound (X) payload
Undisclosed
CD33-A Antibody-Compound (X) linker
[8]
CD33-A Antibody-Compound (XI)
CD33-A Antibody-Compound (XI) payload
Undisclosed
CD33-A Antibody-Compound (XI) linker
[8]
CD33-A Antibody-Compound (XIV)
CD33-A Antibody-Compound (XIV) payload
Undisclosed
CD33-A Antibody-Compound (XIV) linker
[8]
CD33-A Antibody-Compound (XIX)
CD33-A Antibody-Compound (XIX) payload
Undisclosed
CD33-A Antibody-Compound (XIX) linker
[8]
CD33-A Antibody-Compound (XL)
CD33-A Antibody-Compound (XL) payload
Undisclosed
CD33-A Antibody-Compound (XL) linker
[8]
CD33-A Antibody-Compound (XLI)
CD33-A Antibody-Compound (XLI) payload
Undisclosed
CD33-A Antibody-Compound (XLI) linker
[8]
CD33-A Antibody-Compound (XLII)
CD33-A Antibody-Compound (XLII) payload
Undisclosed
CD33-A Antibody-Compound (XLII) linker
[8]
CD33-A Antibody-Compound (XLIII)
CD33-A Antibody-Compound (XLIII) payload
Undisclosed
CD33-A Antibody-Compound (XLIII) linker
[8]
CD33-A Antibody-Compound (XV)
CD33-A Antibody-Compound (XV) payload
Undisclosed
CD33-A Antibody-Compound (XV) linker
[8]
CD33-A Antibody-Compound (XVI)
CD33-A Antibody-Compound (XIX) payload
Undisclosed
CD33-A Antibody-Compound (XIX) linker
[8]
CD33-A Antibody-Compound (XVIII)
CD33-A Antibody-Compound (XVIII) payload
Undisclosed
CD33-A Antibody-Compound (XVIII) linker
[8]
CD33-B Anti-ody
ADC Info ADC Name Payload Target Linker Ref
CD33-B Antibody-Compound (Ie)
CD33-B Antibody-Compound (Ie) payload
Undisclosed
CD33-B Antibody-Compound (Ie) linker
[8]
CD33-B Antibody-Compound (Ii)
CD33-B Antibody-Compound (Ii) payload
Undisclosed
CD33-B Antibody-Compound (Ii) linker
[8]
CD33-B Antibody-Compound (X)
CD33-B Antibody-Compound (X) payload
Undisclosed
CD33-B Antibody-Compound (X) linker
[8]
CD33-B Antibody-Compound (XI)
CD33-B Antibody-Compound (XI) payload
Undisclosed
CD33-B Antibody-Compound (XI) linker
[8]
CD33-B Antibody-Compound (XIV)
CD33-B Antibody-Compound (XIV) payload
Undisclosed
CD33-B Antibody-Compound (XIV) linker
[8]
CD33-B Antibody-Compound (XIX)
CD33-B Antibody-Compound (XIX) payload
Undisclosed
CD33-B Antibody-Compound (XIX) linker
[8]
CD33-B Antibody-Compound (XL)
CD33-B Antibody-Compound (XL) payload
Undisclosed
CD33-B Antibody-Compound (XL) linker
[8]
CD33-B Antibody-Compound (XLI)
CD33-B Antibody-Compound (XLI) payload
Undisclosed
CD33-B Antibody-Compound (XLI) linker
[8]
CD33-B Antibody-Compound (XLII)
CD33-B Antibody-Compound (XLII) payload
Undisclosed
CD33-B Antibody-Compound (XLII) linker
[8]
CD33-B Antibody-Compound (XLIII)
CD33-B Antibody-Compound (XLIII) payload
Undisclosed
CD33-B Antibody-Compound (XLIII) linker
[8]
CD33-B Antibody-Compound (XV)
CD33-B Antibody-Compound (XV) payload
Undisclosed
CD33-B Antibody-Compound (XV) linker
[8]
CD33-B Antibody-Compound (XVI)
CD33-B Antibody-Compound (XIX) payload
Undisclosed
CD33-B Antibody-Compound (XIX) linker
[8]
CD33-B Antibody-Compound (XVIII)
CD33-B Antibody-Compound (XVIII) payload
Undisclosed
CD33-B Antibody-Compound (XVIII) linker
[8]
CD33-C Anti-ody
ADC Info ADC Name Payload Target Linker Ref
CD33-C Antibody-Compound (Ie)
CD33-C Antibody-Compound (Ie) payload
Undisclosed
CD33-C Antibody-Compound (Ie) linker
[8]
CD33-C Antibody-Compound (Ii)
CD33-C Antibody-Compound (Ii) payload
Undisclosed
CD33-C Antibody-Compound (Ii) linker
[8]
CD33-C Antibody-Compound (X)
CD33-C Antibody-Compound (X) payload
Undisclosed
CD33-C Antibody-Compound (X) linker
[8]
CD33-C Antibody-Compound (XI)
CD33-C Antibody-Compound (XI) payload
Undisclosed
CD33-C Antibody-Compound (XI) linker
[8]
CD33-C Antibody-Compound (XIV)
CD33-C Antibody-Compound (XIV) payload
Undisclosed
CD33-C Antibody-Compound (XIV) linker
[8]
CD33-C Antibody-Compound (XIX)
CD33-C Antibody-Compound (XIX) payload
Undisclosed
CD33-C Antibody-Compound (XIX) linker
[8]
CD33-C Antibody-Compound (XL)
CD33-C Antibody-Compound (XL) payload
Undisclosed
CD33-C Antibody-Compound (XL) linker
[8]
CD33-C Antibody-Compound (XLI)
CD33-C Antibody-Compound (XLI) payload
Undisclosed
CD33-C Antibody-Compound (XLI) linker
[8]
CD33-C Antibody-Compound (XLII)
CD33-C Antibody-Compound (XLII) payload
Undisclosed
CD33-C Antibody-Compound (XLII) linker
[8]
CD33-C Antibody-Compound (XLIII)
CD33-C Antibody-Compound (XLIII) payload
Undisclosed
CD33-C Antibody-Compound (XLIII) linker
[8]
CD33-C Antibody-Compound (XV)
CD33-C Antibody-Compound (XV) payload
Undisclosed
CD33-C Antibody-Compound (XV) linker
[8]
CD33-C Antibody-Compound (XVI)
CD33-C Antibody-Compound (XIX) payload
Undisclosed
CD33-C Antibody-Compound (XIX) linker
[8]
CD33-C Antibody-Compound (XVIII)
CD33-C Antibody-Compound (XVIII) payload
Undisclosed
CD33-C Antibody-Compound (XVIII) linker
[8]
CD33-D Anti-ody
ADC Info ADC Name Payload Target Linker Ref
CD33-D Antibody-Compound (Ie)
CD33-D Antibody-Compound (Ie) payload
Undisclosed
CD33-D Antibody-Compound (Ie) linker
[8]
CD33-D Antibody-Compound (Ii)
CD33-D Antibody-Compound (Ii) payload
Undisclosed
CD33-D Antibody-Compound (Ii) linker
[8]
CD33-D Antibody-Compound (X)
CD33-D Antibody-Compound (X) payload
Undisclosed
CD33-D Antibody-Compound (X) linker
[8]
CD33-D Antibody-Compound (XI)
CD33-D Antibody-Compound (XI) payload
Undisclosed
CD33-D Antibody-Compound (XI) linker
[8]
CD33-D Antibody-Compound (XIV)
CD33-D Antibody-Compound (XIV) payload
Undisclosed
CD33-D Antibody-Compound (XIV) linker
[8]
CD33-D Antibody-Compound (XIX)
CD33-D Antibody-Compound (XIX) payload
Undisclosed
CD33-D Antibody-Compound (XIX) linker
[8]
CD33-D Antibody-Compound (XL)
CD33-D Antibody-Compound (XL) payload
Undisclosed
CD33-D Antibody-Compound (XL) linker
[8]
CD33-D Antibody-Compound (XLI)
CD33-D Antibody-Compound (XLI) payload
Undisclosed
CD33-D Antibody-Compound (XLI) linker
[8]
CD33-D Antibody-Compound (XLII)
CD33-D Antibody-Compound (XLII) payload
Undisclosed
CD33-D Antibody-Compound (XLII) linker
[8]
CD33-D Antibody-Compound (XLIII)
CD33-D Antibody-Compound (XLIII) payload
Undisclosed
CD33-D Antibody-Compound (XLIII) linker
[8]
CD33-D Antibody-Compound (XV)
CD33-D Antibody-Compound (XV) payload
Undisclosed
CD33-D Antibody-Compound (XV) linker
[8]
CD33-D Antibody-Compound (XVI)
CD33-D Antibody-Compound (XIX) payload
Undisclosed
CD33-D Antibody-Compound (XIX) linker
[8]
CD33-D Antibody-Compound (XVIII)
CD33-D Antibody-Compound (XVIII) payload
Undisclosed
CD33-D Antibody-Compound (XVIII) linker
[8]
CN105828840B_ADC-125 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-125
CN105828840B_ADC-125 payload
Undisclosed
CN105828840B_ADC-125 linker
[9]
CN105828840B_ADC-127 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-127
CN105828840B_ADC-127 payload
Undisclosed
CN105828840B_ADC-127 linker
[9]
CN105828840B_ADC-129 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-129
CN105828840B_ADC-129 payload
Undisclosed
CN105828840B_ADC-129 linker
[9]
CN105828840B_ADC-131 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-131
CN105828840B_ADC-131 payload
Undisclosed
CN105828840B_ADC-131 linker
[9]
CN105828840B_ADC-133 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-133
CN105828840B_ADC-133 payload
Undisclosed
CN105828840B_ADC-133 linker
[9]
CN105828840B_ADC-137 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-137
CN105828840B_ADC-137 payload
Undisclosed
CN105828840B_ADC-137 linker
[9]
CN105828840B_ADC-138 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-138
CN105828840B_ADC-138 payload
Undisclosed
CN105828840B_ADC-138 linker
[9]
CN105828840B_ADC-139 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-139
CN105828840B_ADC-139 payload
Undisclosed
CN105828840B_ADC-139 linker
[9]
Gemtuzumab
ADC Info ADC Name Payload Target Linker Ref
Gemtuzumab ozogamicin
N-acetyl-gamma-calicheamicin
Human Deoxyribonucleic acid (hDNA)
AcButDMH
[10]
BL-M11D1
Camptothecin analogue ED04
DNA topoisomerase 1 (TOP1)
Gly-Mal-Gly-Gly-Phe-Gly
[11]
Gemtuzumab-Compound (Ie)
NeoDegrader P1
Protein cereblon (CRBN)
Gemtuzumab-Compound (Ie) linker
[7]
Gemtuzumab-Compound (Ie)
Gemtuzumab-Compound (Ie) payload
Undisclosed
Gemtuzumab-Compound (Ie) linker
[8]
Gemtuzumab-ADC-24-1
Gemtuzumab-ADC-24-1 payload
Undisclosed
Gemtuzumab-ADC-24-1 linker
[12]
Gemtuzumab-ADC-24-10
Gemtuzumab-ADC-24-10 payload
Undisclosed
Gemtuzumab-ADC-24-10 linker
[12]
Gemtuzumab-ADC-24-11
Gemtuzumab-ADC-24-11 payload
Undisclosed
Gemtuzumab-ADC-24-11 linker
[12]
Gemtuzumab-ADC-24-12
Gemtuzumab-ADC-24-12 payload
Undisclosed
Gemtuzumab-ADC-24-12 linker
[12]
Gemtuzumab-ADC-24-13
Gemtuzumab-ADC-24-13 payload
Undisclosed
Gemtuzumab-ADC-24-13 linker
[12]
Gemtuzumab-ADC-24-2
Gemtuzumab-ADC-24-2 payload
Undisclosed
Gemtuzumab-ADC-24-2 linker
[12]
Gemtuzumab-ADC-24-3
Gemtuzumab-ADC-24-3 payload
Undisclosed
Gemtuzumab-ADC-24-3 linker
[12]
Gemtuzumab-ADC-24-4
Gemtuzumab-ADC-24-4 payload
Undisclosed
Gemtuzumab-ADC-24-4 linker
[12]
Gemtuzumab-ADC-24-5
Gemtuzumab-ADC-24-5 payload
Undisclosed
Gemtuzumab-ADC-24-5 linker
[12]
Gemtuzumab-ADC-24-6
Gemtuzumab-ADC-24-6 payload
Undisclosed
Gemtuzumab-ADC-24-6 linker
[12]
Gemtuzumab-ADC-24-7
Gemtuzumab-ADC-24-7 payload
Undisclosed
Gemtuzumab-ADC-24-7 linker
[12]
Gemtuzumab-ADC-24-8
Gemtuzumab-ADC-24-8 payload
Undisclosed
Gemtuzumab-ADC-24-8 linker
[12]
Gemtuzumab-ADC-24-9
Gemtuzumab-ADC-24-9 payload
Undisclosed
Gemtuzumab-ADC-24-9 linker
[12]
Gemtuzumab-Compound (Ia)
NeoDegrader P1
Protein cereblon (CRBN)
Gemtuzumab-Compound (Ia) linker
[7]
Gemtuzumab-Compound (Ib)
NeoDegrader P1
Protein cereblon (CRBN)
Gemtuzumab-Compound (Ib) linker
[7]
Gemtuzumab-Compound (Ic)
NeoDegrader P1
Protein cereblon (CRBN)
Gemtuzumab-Compound (Ic) linker
[7]
Gemtuzumab-Compound (Ih)
NeoDegrader P1
Protein cereblon (CRBN)
Gemtuzumab-Compound (Ih) linker
[7]
Gemtuzumab-Compound (Ii)
Gemtuzumab-Compound (Ii) payload
Undisclosed
Gemtuzumab-Compound (Ii) linker
[8]
Gemtuzumab-Compound (X)
Gemtuzumab-Compound (X) payload
Undisclosed
Gemtuzumab-Compound (X) linker
[8]
Gemtuzumab-Compound (XI)
Gemtuzumab-Compound (XI) payload
Undisclosed
Gemtuzumab-Compound (XI) linker
[8]
Gemtuzumab-Compound (XIV)
Gemtuzumab-Compound (XIV) payload
Undisclosed
Gemtuzumab-Compound (XIV) linker
[8]
Gemtuzumab-Compound (XIX)
Gemtuzumab-Compound (XIX) payload
Undisclosed
Gemtuzumab-Compound (XIX) linker
[8]
Gemtuzumab-Compound (XL)
Gemtuzumab-Compound (XL) payload
Undisclosed
Gemtuzumab-Compound (XL) linker
[8]
Gemtuzumab-Compound (XLI)
Gemtuzumab-Compound (XLI) payload
Undisclosed
Gemtuzumab-Compound (XLI) linker
[8]
Gemtuzumab-Compound (XLII)
Gemtuzumab-Compound (XLII) payload
Undisclosed
Gemtuzumab-Compound (XLII) linker
[8]
Gemtuzumab-Compound (XLIII)
Gemtuzumab-Compound (XLIII) payload
Undisclosed
Gemtuzumab-Compound (XLIII) linker
[8]
Gemtuzumab-Compound (XV)
Gemtuzumab-Compound (XV) payload
Undisclosed
Gemtuzumab-Compound (XV) linker
[8]
Gemtuzumab-Compound (XVI)
Gemtuzumab-Compound (XIX) payload
Undisclosed
Gemtuzumab-Compound (XIX) linker
[8]
Gemtuzumab-Compound (XVIII)
Gemtuzumab-Compound (XVIII) payload
Undisclosed
Gemtuzumab-Compound (XVIII) linker
[8]
Gemtuzumab-Compound 17
Mertansine DM4
Microtubule (MT)
Gemtuzumab-Compound 17 linker
[13]
Gemtuzumab-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 25 linker
[13]
Gemtuzumab-Compound 31
Auristatin 0101
Microtubule (MT)
Gemtuzumab-Compound 31 linker
[13]
Gemtuzumab-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 36 linker
[13]
Gemtuzumab-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Gemtuzumab-Compound 43 linker
[13]
Gemtuzumab-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Gemtuzumab-Compound 49 linker
[13]
Gemtuzumab-Compound 55
Mertansine DM1
Microtubule (MT)
Gemtuzumab-Compound 55 linker
[13]
Gemtuzumab-Compound 59
Mertansine DM4
Microtubule (MT)
Gemtuzumab-Compound 59 linker
[13]
Gemtuzumab-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 64 linker
[13]
Gemtuzumab-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 69 linker
[13]
Gemtuzumab-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Gemtuzumab-Compound 74 linker
[13]
Gemtuzumab-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 75 linker
[13]
Gemtuzumab-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Gemtuzumab-Compound 76 linker
[13]
Gemtuzumab-Compound 77
Mertansine DM1
Microtubule (MT)
Gemtuzumab-Compound 77 linker
[13]
Gemtuzumab-Compound 78
Auristatin 0101
Microtubule (MT)
Gemtuzumab-Compound 78 linker
[13]
Gemtuzumab-Compound 79
Auristatin 0101
Microtubule (MT)
Gemtuzumab-Compound 79 linker
[13]
Gemtuzumab-Compound 80
Mertansine DM4
Microtubule (MT)
Gemtuzumab-Compound 80 linker
[13]
Gemtuzumab-Compound 9
Mertansine DM1
Microtubule (MT)
Gemtuzumab-Compound 9 linker
[13]
huMy9-6 IgG1
ADC Info ADC Name Payload Target Linker Ref
huMy9-6 IgG1-Compound (la) DAR 1.9
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6 IgG1-Compound (la) DAR 1.9 linker
[14]
huMy9-6IgG1-Compound (la) DAR 8
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6IgG1-Compound (la) DAR 8 linker
[14]
huMy9-6IgG1-Compound (la) DAR3.9
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6IgG1-Compound (la) DAR3.9 linker
[14]
huMy9-6IgG1-Compound (ld) DAR 8
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6IgG1-Compound (ld) DAR 8 linker
[14]
huMy9-6IgG1-Compound(la) DAR 5.5
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6IgG1-Compound(la) DAR 5.5 linker
[14]
huMy9-6-IgG4-S228P
ADC Info ADC Name Payload Target Linker Ref
huMy9-6-IgG4-S228P-Compound (Ia)
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6-IgG4-S228P-Compound (Ia) linker
[7]
huMy9-6-IgG4-S228P-Compound (Ib)
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6-IgG4-S228P-Compound (Ib) linker
[7]
huMy9-6-IgG4-S228P-Compound (Ic)
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6-IgG4-S228P-Compound (Ic) linker
[7]
huMy9-6-IgG4-S228P-Compound (Ie)
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6-IgG4-S228P-Compound (Ie) linker
[7]
huMy9-6-IgG4-S228P-Compound (Ih)
NeoDegrader P1
Protein cereblon (CRBN)
huMy9-6-IgG4-S228P-Compound (Ih) linker
[7]
Lintuzumab
ADC Info ADC Name Payload Target Linker Ref
Lintuzumab Ac-225
AC225
Human Deoxyribonucleic acid (hDNA)
DOTA-P-toluene isothiocyanate
[15]
Lintuzumab IgG1-Compound (la) DAR 8
NeoDegrader P1
Protein cereblon (CRBN)
Lintuzumab IgG1-Compound (la) DAR 8 linker
[14]
Lintuzumab IgG1-Compound (ld) DAR 8
NeoDegrader P1
Protein cereblon (CRBN)
Lintuzumab IgG1-Compound (ld) DAR 8 linker
[14]
ADC Info ADC Name Payload Target Linker Ref
OR000213-Compound (Ia)
NeoDegrader P1
Protein cereblon (CRBN)
OR000213-Compound (Ia) linker
[14]
OR000213-Compound (la) DAR 1.2
NeoDegrader P1
Protein cereblon (CRBN)
OR000213-Compound (la) DAR 1.2 linker
[14]
OR000213-Compound(la) DAR 1.8
NeoDegrader P1
Protein cereblon (CRBN)
OR000213-Compound(la) DAR 1.8 linker
[14]
OR000213-Compound(la) DAR 2.3
NeoDegrader P1
Protein cereblon (CRBN)
OR000213-Compound(la) DAR 2.3 linker
[14]
OR000213-Compound(la) DAR 8
NeoDegrader P1
Protein cereblon (CRBN)
OR000213-Compound(la) DAR 8 linker
[14]
ADC Info ADC Name Payload Target Linker Ref
ORM-6151
SMol006
Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (GSPT1)
#NAME?
Thio hu Anti-CD33 GM15.33 HC A118C
ADC Info ADC Name Payload Target Linker Ref
WO2014159981A2 ADC-203
WO2014159981A2_ADC-203 payload
Undisclosed
WO2014159981A2_ADC-203 linker
[16]
WO2014159981A2 ADC-213
WO2014159981A2_ADC-213 payload
Undisclosed
WO2014159981A2_ADC-213 linker
[16]
WO2014159981A2 ADC-222
WO2014159981A2_ADC-222 payload
Undisclosed
WO2014159981A2_ADC-222 linker
[16]
WO2014159981A2 ADC-CD33-24
WO2014159981A2_ADC-CD33-24 payload
Undisclosed
WO2014159981A2_ADC-CD33-24 linker
[16]
WO2014159981A2 ADC-CD33-25
WO2014159981A2_ADC-CD33-25 payload
Undisclosed
WO2014159981A2_ADC-CD33-25 linker
[16]
WO2014159981A2 ADC-CD33-33
WO2014159981A2_ADC-CD33-33 payload
Undisclosed
WO2014159981A2_ADC-CD33-33 linker
[16]
WO2014159981A2 ADC-CD33-37
WO2014159981A2_ADC-CD33-37 payload
Undisclosed
WO2014159981A2_ADC-CD33-37 linker
[16]
WO2014159981A2 ADC-CD33-41
WO2014159981A2_ADC-CD33-41 payload
Undisclosed
WO2014159981A2_ADC-CD33-41 linker
[16]
WO2014159981A2 ADC-CD33-44
WO2014159981A2_ADC-CD33-44 payload
Undisclosed
WO2014159981A2_ADC-CD33-44 linker
[16]
Vadastuximab
ADC Info ADC Name Payload Target Linker Ref
Vadastuximab talirine
SGD-1882
Human Deoxyribonucleic acid (hDNA)
Mc-Val-Ala
[17]
ADC Info ADC Name Payload Target Linker Ref
IMGN-779
DGN462
Human Deoxyribonucleic acid (hDNA)
Sulfo-SPDB
[18]
undisclosed
ADC Info ADC Name Payload Target Linker Ref
ABBV-787
BET degrader
BET
undisclosed
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
Anti-CD3 single-chain immunotoxin
DT390-scFvUCHT1
Undisclosed
Undisclosed
[19]
Anti-CD33 next-generation DNA-targeting payload ADC (Pfizer)
Undisclosed
Undisclosed
Undisclosed
[20]
Indolino-benzodiazepine antibody drug conjugate
Undisclosed
Undisclosed
Undisclosed
[21]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.26E-10; Fold-change: 0.314079456; Z-score: 0.967657543
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.441339172; Fold-change: -0.914552317; Z-score: -1.02637046
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.180863381; Fold-change: 0.762904172; Z-score: 0.7480412
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.17E-07; Fold-change: -1.076597336; Z-score: -3.224803207
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.10E-09; Fold-change: 0.201035326; Z-score: 0.442817729
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.469079159; Fold-change: 0.064429883; Z-score: 0.257024289
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.618066778; Fold-change: -0.013498748; Z-score: -0.053843665
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005032218; Fold-change: 0.274846965; Z-score: 0.473298153
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00248525; Fold-change: 2.525576797; Z-score: 4.370846507
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.299288387; Fold-change: 0.057204909; Z-score: 0.644644301
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.679929424; Fold-change: -0.105642199; Z-score: -0.860748877
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.126549121; Fold-change: 0.121986318; Z-score: 0.491885589
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.59E-23; Fold-change: -0.405560115; Z-score: -1.087128152
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000148858; Fold-change: -0.187354456; Z-score: -0.405174272
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.173733362; Fold-change: 0.087089785; Z-score: 0.180005426
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006464504; Fold-change: -0.067088655; Z-score: -0.121367895
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.62E-07; Fold-change: -0.320302205; Z-score: -1.141620863
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.43E-21; Fold-change: -0.427116203; Z-score: -1.00109189
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.018025535; Fold-change: -0.878958673; Z-score: -2.846802965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.51E-60; Fold-change: -0.83185502; Z-score: -1.789528367
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.09E-42; Fold-change: -0.900503762; Z-score: -1.868569621
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.07E-06; Fold-change: 0.460094625; Z-score: 0.934589322
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.04E-06; Fold-change: -0.053665412; Z-score: -0.136514096
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.202795601; Fold-change: -0.426680525; Z-score: -1.545086404
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.72E-25; Fold-change: -0.440436203; Z-score: -0.841835421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000180606; Fold-change: -0.268569442; Z-score: -0.504266611
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007614477; Fold-change: 0.364277838; Z-score: 1.141354714
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.993340092; Fold-change: 0.23098312; Z-score: 0.280021302
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.662419235; Fold-change: 0.127586991; Z-score: 0.353301097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.35E-06; Fold-change: 0.17878966; Z-score: 0.346728765
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000385379; Fold-change: 1.141969968; Z-score: 4.151064208
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001524126; Fold-change: -0.259230041; Z-score: -0.556985699
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014101812; Fold-change: 0.644972919; Z-score: 1.560094129
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.918295356; Fold-change: 0.126952925; Z-score: 0.614512512
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.79E-14; Fold-change: 0.501286506; Z-score: 0.93895949
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.24E-08; Fold-change: 0.472078505; Z-score: 1.09799793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.000102759; Fold-change: -0.500527347; Z-score: -1.201934807
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015539225; Fold-change: 0.082093261; Z-score: 0.225591286
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.086632812; Fold-change: 0.225369857; Z-score: 0.584566427
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02381192; Fold-change: 0.268399573; Z-score: 0.674493064
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.718650921; Fold-change: 0.767065908; Z-score: 0.650054885
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.88E-05; Fold-change: 0.36080115; Z-score: 0.334396514
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.937023062; Fold-change: -0.250066957; Z-score: -0.432742027
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.34E-20; Fold-change: 2.121685605; Z-score: 2.391979147
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.958337312; Fold-change: 0.01138344; Z-score: 0.077847602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.986538874; Fold-change: 0.042341534; Z-score: 0.110856344
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.468956229; Fold-change: 0.048998569; Z-score: 0.152568927
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.625943549; Fold-change: -0.04181638; Z-score: -0.261087131
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.0584731; Fold-change: 0.209233691; Z-score: 0.639818138
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.870881278; Fold-change: 0.080148211; Z-score: 0.127663846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.177700734; Fold-change: -0.216048472; Z-score: -0.59929453
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.303628012; Fold-change: -0.81322717; Z-score: -1.267394826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.903895373; Fold-change: -0.191715574; Z-score: -0.145725562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.68E-09; Fold-change: 0.636912074; Z-score: 1.209749128
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.50E-10; Fold-change: 0.291187012; Z-score: 0.761624551
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000581663; Fold-change: 0.630986525; Z-score: 0.987018973
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.347790822; Fold-change: -0.378363304; Z-score: -1.478267891
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.68E-06; Fold-change: 1.962352418; Z-score: 1.293439159
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.583674353; Fold-change: -0.509297141; Z-score: -0.603169062
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.198541107; Fold-change: 0.118402841; Z-score: 0.244926255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.225430737; Fold-change: -0.348426988; Z-score: -0.486868254
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000191659; Fold-change: 1.984458229; Z-score: 6.291293316
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034531453; Fold-change: 0.192794352; Z-score: 0.915632303
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.094137721; Fold-change: -0.627093509; Z-score: -1.527167331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.552079576; Fold-change: 0.124780952; Z-score: 0.177095818
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.323199955; Fold-change: 0.070855343; Z-score: 0.385694446
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.501652959; Fold-change: 0.125205304; Z-score: 0.35686632
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001156722; Fold-change: 0.285090157; Z-score: 0.668389474
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.029596081; Fold-change: 0.140940948; Z-score: 0.258794314
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.526069144; Fold-change: -0.009131304; Z-score: -0.05167995
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.435304189; Fold-change: -0.344971216; Z-score: -0.654748974
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.10E-09; Fold-change: 0.319052996; Z-score: 0.947702695
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.01163384; Fold-change: 0.306033263; Z-score: 1.754566473
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.78E-05; Fold-change: 0.916416539; Z-score: 3.060484344
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.523662864; Fold-change: 0.038189907; Z-score: 0.168699999
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.305439412; Fold-change: -0.074529581; Z-score: -0.128472556
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.142028625; Fold-change: 0.04098346; Z-score: 0.177652971
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.366942433; Fold-change: -0.004048089; Z-score: -0.011018346
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.862039448; Fold-change: -0.020452782; Z-score: -0.032811122
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.425668184; Fold-change: 0.117595118; Z-score: 0.318361808
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.50E-08; Fold-change: 0.465120604; Z-score: 0.987329288
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.197643027; Fold-change: -0.127875012; Z-score: -0.716701682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.637926359; Fold-change: -0.208317428; Z-score: -0.287045384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.580653846; Fold-change: 0.202823213; Z-score: 0.547663349
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.58E-05; Fold-change: -0.462018144; Z-score: -0.771849359
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.106059668; Fold-change: 0.078441557; Z-score: 0.233003991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.527836155; Fold-change: 0.141339503; Z-score: 0.540705884
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.18224516; Fold-change: 0.238759471; Z-score: 1.998325639
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030942268; Fold-change: 0.571418904; Z-score: 1.063010396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007035565; Fold-change: 0.793054524; Z-score: 2.432108711
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.700993885; Fold-change: 0.042213977; Z-score: 0.152824355
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.37E-13; Fold-change: 0.57838886; Z-score: 1.127366157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000152943; Fold-change: -0.671722137; Z-score: -2.698853852
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010566745; Fold-change: 0.35466069; Z-score: 1.065258007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.40E-05; Fold-change: -0.547724744; Z-score: -1.222603733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.10E-06; Fold-change: -0.28396826; Z-score: -0.682661074
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.413250384; Fold-change: -0.157927965; Z-score: -0.309874236
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005266742; Fold-change: -0.421946902; Z-score: -1.967270713
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.063321675; Fold-change: -0.344401376; Z-score: -1.007799157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.210388107; Fold-change: -0.106575748; Z-score: -0.251262101
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.740294482; Fold-change: -0.091853784; Z-score: -0.148374003
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.270880571; Fold-change: -0.045654989; Z-score: -0.082611294
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.754938692; Fold-change: -0.122394645; Z-score: -0.201778286
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.455764886; Fold-change: -0.035274765; Z-score: -0.136527818
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.735189755; Fold-change: 0.020706147; Z-score: 0.364680473
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.140997087; Fold-change: 0.453892881; Z-score: 2.05453469
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001902367; Fold-change: -0.589888143; Z-score: -2.53068542
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00336045; Fold-change: -0.284358768; Z-score: -0.858139656
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.833188041; Fold-change: 0.080199007; Z-score: 0.323857435
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.24E-06; Fold-change: 0.70516659; Z-score: 3.485711917
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.796627955; Fold-change: -0.16987837; Z-score: -0.800097991
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.27282997; Fold-change: -0.424638245; Z-score: -2.207554488
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.747497743; Fold-change: -0.031984089; Z-score: -0.210344612
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.872599884; Fold-change: -0.517961608; Z-score: -1.106310275
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.366805522; Fold-change: 0.078597672; Z-score: 0.375969453
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.07538816; Fold-change: -0.051550865; Z-score: -0.209863343
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.064495664; Fold-change: 0.22036411; Z-score: 0.558817231
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.370738287; Fold-change: 0.351315418; Z-score: 0.692188494
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.842277404; Fold-change: 0.228699903; Z-score: 0.488252521
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.05576914; Fold-change: 0.199703514; Z-score: 0.773797754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.85430777; Fold-change: -0.041875909; Z-score: -0.07451898
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.289713071; Fold-change: 0.242993091; Z-score: 0.864862175
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.208986759; Fold-change: 0.034855435; Z-score: 0.035463569
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000371885; Fold-change: 0.166589772; Z-score: 0.696762092
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.150927103; Fold-change: -0.070248431; Z-score: -0.174518656
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.517045504; Fold-change: -0.086309829; Z-score: -0.856007291
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.257972331; Fold-change: 0.247575329; Z-score: 0.661822032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.74E-05; Fold-change: 0.737121504; Z-score: 1.985971501
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.036314172; Fold-change: 0.40964765; Z-score: 1.253429377
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Anti-graft-versus-host disease effect of DT390-anti-CD3sFv, a single-chain Fv fusion immunotoxin specifically targeting the CD3 epsilon moiety of the T-cell receptor. Blood. 1996 Sep 15;88(6):2342-53.
Ref 2 Neodegrader-anti-cd33 antibody conjugates; 2022-12-08.
Ref 3 Development of Highly Optimized Antibody-Drug Conjugates against CD33 and CD123 for Acute Myeloid Leukemia. Clin Cancer Res. 2021 Jan 15;27(2):622-631. doi: 10.1158/1078-0432.CCR-20-2149. Epub 2020 Nov 4.
Ref 4 Peptidomimetic compounds and antibody-drug conjugates thereof; 2015-09-03.
Ref 5 Cyclodextrin and antibody-drug conjugate formulations.
Ref 6 Phase I studies of AVE9633, an anti-CD33 antibody-maytansinoid conjugate, in adult patients with relapsed/refractory acute myeloid leukemia. Invest New Drugs. 2012 Jun;30(3):1121-31. doi: 10.1007/s10637-011-9670-0. Epub 2011 Apr 26.
Ref 7 Neodegrader conjugates; 2021-10-07.
Ref 8 Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 9 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment.
Ref 10 Gemtuzumab ozogamicin in acute myeloid leukemia: act 2, with perhaps more to come. Haematologica. 2019 Jan;104(1):7-9. doi: 10.3324/haematol.2018.205948.
Ref 11 A study of BL-M11D1 in patients with relapsed/refractory acute myeloid leukemia.
Ref 12 Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof; 2020-04-02.
Ref 13 Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 14 Neodegrader conjugates; 2021-10-07.
Ref 15 Treatment of Patients with Acute Myeloid Leukemia with the Targeted Alpha-Particle Nanogenerator Actinium-225-Lintuzumab. Clin Cancer Res. 2022 May 13;28(10):2030-2037. doi: 10.1158/1078-0432.CCR-21-3712.
Ref 16 Pyrrolobenzodiazepines and conjugates thereof; 2015-04-09.
Ref 17 SGN-CD33A: a novel CD33-targeting antibody-drug conjugate using a pyrrolobenzodiazepine dimer is active in models of drug-resistant AML. Blood. 2013 Aug 22;122(8):1455-63.
Ref 18 IMGN779, a Novel CD33-Targeting Antibody-Drug Conjugate with DNA-Alkylating Activity, Exhibits Potent Antitumor Activity in Models of AML. Mol Cancer Ther. 2018 Jun;17(6):1271-1279. doi: 10.1158/1535-7163.MCT-17-1077. Epub 2018 Mar 27.
Ref 19 Expression of an anti-CD3 single-chain immunotoxin with a truncated diphtheria toxin in a mutant CHO cell line. Protein Expr Purif. 2000 Jul;19(2):304-11. doi: 10.1006/prep.2000.1255.
Ref 20 Introduction to basic information on anti-CD33 targeting next-generation DNA-targeting payload antibody-drug conjugates(Pfizer).
Ref 21 Characterization of the taxol structure-activity profile for the locus of the a-ring side-chain. Bioorg Med Chem Lett. 1994;4(12):1531-1536.