Antibody Information
General Information of This Antibody
| Antibody ID | ANI0TZGUL |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Lintuzumab |
|||||
| Brand Name | Zamyl |
|||||
| Organization | PDL BioPharma, Inc.; Seagen Inc. |
|||||
| Indication | Acute myeloid leukemia; Acute promyelocytic leukemia; Myelodysplastic syndromes |
|||||
| Synonyms |
HUM195; HUM-195; LINTUZUMAB; SGN-33; Zamyl
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Myeloid cell surface antigen CD33 (CD33) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| DrugBank ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGY
NQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGS
GVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQSKEVPWTFGQGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Lintuzumab Ac-225 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT06802523 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study of Lintuzumab-Ac-225 in Combination With Venetoclax and ASTX-727 in Adults With Newly Diagnosed AML
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Inclusion criteria: Phase I - untreated AML (including secondary/prior MDS) patients ≥60 years (or ≥70) unfit for intensive chemo, with ≥20% blasts (>25% CD33+), adequate organ function, ECOG≤3; Phase II - similar diagnosis with additional cardio-pulmonary-hepatic-renal comorbidity specifications, circulating blasts <200/mm <sup>3</sup> (hydroxyurea allowed), stricter organ function thresholds (Cr<2.0 mg/dL, CrCl≥50 mL/min, bilirubin≤2.0 mg/dL, AST/ALT<5×ULN), and ECOG≤2.
Click to Show/Hide
|
||||
| Administration Dosage |
Cytarabine + Lintuzumab-Ac225 Cytarabine days 1 to 10 of each cycle. Doses were divided into 2 equal fractions with the first fraction given approx. 4-7 days after 1 cycle of low dose cytarabine and the second fraction given 4-7 days after the first fraction, followed by up to 11 more cycles. Furosemide (Phase 1 only) and Spironolactone were administered after Lintuzumab-Ac225.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02575963 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II Study of Lintuzumab-Ac225 in Older Patients With Untreated Acute Myeloid Leukemia
|
||||
| Primary Endpoint |
Phase I primary endpoint: MTD determination of Lintuzumab-Ac225 [Cycle 1, up to 52 days] with DLT evaluation in cohorts (MTD exceeded if ≥2/3-6 patients experience DLT). Phase II primary endpoint: composite complete response rate (CR+CRp+CRi) [First evaluation at 42 days post-treatment] to assess antileukemic activity.
|
||||
| Other Endpoint |
Phase II secondary endpoints: PFS, LFS, and OS [all at 1 year], along with toxicity spectrum evaluation for safety assessment [1 year].
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Key inclusion: Age≥18 with relapsed/refractory AML (primary/secondary/t-AML) or MDS-progressed AML, ECOG 0-2, >25% CD33+ blasts, bilirubin≤2xULN, AST/ALT≤5xULN, CrCl≥50mL/min, LVEF>40%, with contraception requirements.
|
||||
| Administration Dosage |
Lintuzumab Ac225 (Dose 1 - 0.25 uCi/kg Ac-225 with 1.6 ug/kg lintuzumab)
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03441048 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study of Lintuzumab-Ac225 in Combination with CLAG-M Chemotherapy in Patients with Relapsed/Refractory Acute Myeloid Leukemia
|
||||
| Primary Endpoint |
Primary endpoints include DLT assessment [28 days] using a 3+3 dose-escalation design (0.25-1.25 uCi/kg) with MTD defined as the highest dose where ≤1/6 subjects experience DLT, SAE monitoring per CTCAE v4.03 [60 days], and 2-year OS.
|
||||
| Other Endpoint |
Secondary efficacy endpoints: CR (BM blasts <5% with ANC≥1000/uL & platelets≥100k/uL), CRi (CR without count recovery), MLFS (blasts <5% without count recovery), PR (≥50% blast reduction to <25% with normalized counts) [all up to Day 60], and 1-year PFS.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Key inclusion: R/R AML (primary/secondary/ts-AML) with ≥1 prior treatment failure or relapse (≥5% BM blasts), circulating blasts ≤200/uL (hydroxyurea permitted), ECOG≤2, CrCl≥50mL/min, AST/ALT≤3xULN, bilirubin≤3xULN.
|
||||
| Administration Dosage |
Lintuzumab-Ac225 administered on Day 5 of each cycle for four cycles (unless in the 0.5 uCi/kg or 0.25 uCi/kg cohorts, where there is a potential for an additional four cycles, pending PI and Medical Monitor review).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03867682 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II Study of Venetoclax and Lintuzumab-Ac225 in Patients With Refractory or Relapsed AML
|
||||
| Primary Endpoint |
Primary objectives include MTD determination of Lintuzumab-Ac225 combined with venetoclax in R/R AML (CD33+) [Cycle 1, up to 48 days] and assessment of overall response rate (CR+CRh+CRi) [6 months].
|
||||
| Other Endpoint |
Secondary endpoints: ORR (CR/CRh/CRi), OS/DFS at 6/12/24 months, AE/SAE incidence [2 years], BH3 priming assay results [Cycle 1], MRD negativity rate [from first dose], and Grade 3/4 lab abnormalities [2 years].
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Key inclusion: Histologically confirmed R/R AML (primary/secondary/ts-AML) with ≥1 prior treatment failure or relapse (≥5% BM blasts), WBC<10×10<sup>9</sup>/L (hydroxyurea permitted), age>18, CrCl≥50mL/min, AST/ALT≤3xULN, bilirubin≤3xULN, ECOG≤2.
|
||||
| Administration Dosage |
Lintuzumab-Ac225 will be administered on Day 8 of each cycle for four cycles (unless in the 0.5 uCi/kg or 0.25 uCi/kg cohorts, where there is a potential for an additional four cycles, pending PI and Medical Monitor review).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03932318 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II Study of Venetoclax and Azacitidine and Lintuzumab-Ac225 in Patients With Refractory or Relapsed AML
|
||||
| Primary Endpoint |
Primary objectives include determining the MTD of Lintuzumab-Ac225 in combination with venetoclax/azacitidine for CD33+ AML [Cycle 1, up to 48 days] and assessing overall response rate (CR+CRh+CRi+MLFS) [6 months].
|
||||
| Other Endpoint |
Secondary endpoints: ORR (CR/CRh/CRi/MLFS), OS at 6/12/24 months (Phase I/II), DFS [2 years], AE/SAE incidence [2 years], Grade 3/4 lab abnormalities [2 years], BH3 priming assay results [Cycle 1], and MRD negativity rate [from first dose].
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Key inclusion: Confirmed relapsed/refractory multiple myeloma (≥3 prior regimens) with measurable disease (serum M-protein ≥0.5g/dL IgG/IgA or urinary light chain ≥200mg/24h), CD33+ expression in >25% myeloma cells, resolved toxicities (Grade ≤2), normal electrolytes, adequate organ function, and ECOG ≤2.
|
||||
| Administration Dosage |
Starting dose - 0.5 uCi/Kg IV infusion of Lintuzumab AC225 on Day 1 of each cycle with dose escalation 1 uCi/Kg and 1.5 uCi/Kg or de-escalation to 0.25 uCi/Kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02998047 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study of Lintuzumab-Ac225 in Patients With Refractory Multiple Myeloma
|
||||
| Primary Endpoint |
Primary objectives include establishing the MTD of Lintuzumab-AC225 monotherapy [average 2.5 years] and evaluating treatment-emergent adverse events for safety assessment [average 2.5 years].
|
||||
| Other Endpoint |
Secondary endpoints: Comprehensive response evaluation (ORR, CR, sCR, VGPR, PR), PFS, and OS [all average 2.5 years], with efficacy assessments including serum/urine paraprotein levels and bone marrow analyses.
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
67%
|
|||
| Patients Enrolled |
Patients with more than 25% of leukemic blasts must have been CD33 positive by flow cytometry.
|
||||
| Administration Dosage |
Induction consisted of G-CSF, 300 mg/d, given D1-6, cladribine 5 mg/m2, given D2-6, cytarabine 2 ug/m2, given D2-6, and mitoxantrone 10 mg/m2, given D2-4. Lintuzumab Ac225 was administered as a single dose on either day 7, 8, or 9 with a dose of 0.25 uCi/kg, 0.50 uCi/kg, or 0.75 uCi/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03441048 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of lintuzumab-Ac225 in combination with CLAG-M chemotherapy in patients with relapsed/refractory acute myeloid leukemia.
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [8] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT02575963 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1/2 study of lintuzumab-Ac225 in older patients with untreated acute myeloid leukemia.
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [9] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03932318 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1/2 study of venetoclax and azacitidine and lintuzumab-Ac225 in patients with refractory or relapsed AML.
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [10] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03867682 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1/2 study of venetoclax and lintuzumab-Ac225 in patients with refractory or relapsed AML.
|
||||
| Experiment 11 Reporting the Activity Date of This ADC | [11] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT02998047 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of lintuzumab-Ac225 in patients with refractory multiple myeloma.
|
||||
Lintuzumab IgG1-Compound (la) DAR 8 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [12] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
12 pM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
Lintuzumab IgG1-Compound (ld) DAR 8 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [12] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 50 pM | Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
GLK-33 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.14 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.21 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.24 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Acute myeloblastic leukemia with maturation, Adult acute myeloid leukemia with maturation | HL60 cells | CVCL_0002 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.4 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | KG-1 cells | CVCL_0374 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
2.7 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
725 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 1000 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 1000 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
GLK-33 exhibited remarkable efficacy in reducing cell viability within CD33-positive leukemia cell lines.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
References