General Information of This Antibody
Antibody ID
ANI0TZGUL
Antibody Name
Lintuzumab
Brand Name
Zamyl
Organization
PDL BioPharma, Inc.; Seagen Inc.
Indication
Acute myeloid leukemia; Acute promyelocytic leukemia; Myelodysplastic syndromes
Synonyms
HUM195; HUM-195; LINTUZUMAB; SGN-33; Zamyl
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Myeloid cell surface antigen CD33 (CD33)
 Antigen Info 
ChEMBI ID
CHEMBL2109150
DrugBank ID
DB14877
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGY
NQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGS
GVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQSKEVPWTFGQGTKVEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Lintuzumab Ac-225 [Phase 1 (Terminated)]
Identified from the Human Clinical Data
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
67.00%
Patients Enrolled
Patients with more than 25% of leukemic blasts must have been CD33 positive by flow cytometry.
Administration Dosage
Induction consisted of G-CSF, 300 mg/d, given D1-6, cladribine 5 mg/m2, given D2-6, cytarabine 2 ug/m2, given D2-6, and mitoxantrone 10 mg/m2, given D2-4. Lintuzumab Ac225 was administered as a single dose on either day 7, 8, or 9 with a dose of 0.25 uCi/kg, 0.50 uCi/kg, or 0.75 uCi/kg.
Related Clinical Trial
NCT Number NCT03441048  Clinical Status Phase 1
Clinical Description
A phase 1 study of lintuzumab-Ac225 in combination with CLAG-M chemotherapy in patients with relapsed/refractory acute myeloid leukemia.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT03932318  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of venetoclax and azacitidine and lintuzumab-Ac225 in patients with refractory or relapsed AML.
Experiment 3 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT03867682  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of venetoclax and lintuzumab-Ac225 in patients with refractory or relapsed AML.
Experiment 4 Reporting the Activity Date of This ADC [4]
Related Clinical Trial
NCT Number NCT02998047  Clinical Status Phase 1
Clinical Description
A phase 1 study of lintuzumab-Ac225 in patients with refractory multiple myeloma.
Experiment 5 Reporting the Activity Date of This ADC [5]
Related Clinical Trial
NCT Number NCT02575963  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of lintuzumab-Ac225 in older patients with untreated acute myeloid leukemia.
Lintuzumab IgG1-Compound (la) DAR 8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
12.00 pM
Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Lintuzumab IgG1-Compound (ld) DAR 8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 50.00 pM Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
References
Ref 1 TROPION-Lung02: Datopotamab deruxtecan (Dato-DXd) plus pembrolizumab (pembro) with or without platinum chemotherapy (Pt-CT) in advanced non-small cell lung cancer (aNSCLC). J Clin Oncol. 2023 41:16_suppl, 9004-9004.
Ref 2 A Phase I/II Study of Venetoclax and Azacitidine and Lintuzumab-Ac225 in Patients With Refractory or Relapsed AML, NCT03932318
Ref 3 A Phase I/II Study of Venetoclax and Lintuzumab-Ac225 in Patients With Refractory or Relapsed AML, NCT03867682
Ref 4 A Phase I Study of Lintuzumab-Ac225 in Patients With Refractory Multiple Myeloma, NCT02998047
Ref 5 A Phase I/II Study of Lintuzumab-Ac225 in Older Patients With Untreated Acute Myeloid Leukemia, NCT02575963
Ref 6 Neodegrader conjugates; 2021-10-07.