General Information of This Antibody
Antibody ID
ANI0NKKSX
Antibody Name
Anti-CD33AB
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1
Antigen Name
Myeloid cell surface antigen CD33 (CD33)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGYTITDSNIHWVRQAPGQSLEWIGYIYPYNGGTDY
NQKFKNRATLTVDNPTNTAYMELSSLRSEDTAFYYCVNGNPWLAYWGQGTLVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTVICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VESCSVMHEALHNHVTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQLTQSPSTLSASVGDRVTITCRASESLDNYGIRFLTWFQQKPGKAPKLLMYAASNQGS
GVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQTKEVPWSFGQGTKVEVKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-CD33AB-Compound (Ih) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 42.35% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lh) was diluted with vehicle, which provided, 2.99 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Anti-CD33AB-Compound (Ia) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 56.31% Positive CD33 expression (CD33+++/++)
Method Description
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (QD, 1 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 71.16% Positive CD33 expression (CD33+++/++)
Method Description
Disseminated model OCI-AML-2 cells (3x10 cells in 0.2 mL) were intravenously injected into the lateral tail vein of female NCG mice. Treatment (iv 3 mg/kg x1) was started thirteen days after tumor cell injection.
In Vivo Model OCI-AML-2 CDX model
In Vitro Model Adult acute myeloid leukemia OCI-AML-2 cells CVCL_1619
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 86.75% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (la) was diluted with vehicle, which provided, 3.02 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.38% Positive CD33 expression (CD33+++/++)
Method Description
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (QD, 3 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97.22% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (la) was diluted with vehicle, which provided, 3.02 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD33 expression (CD33+++/++)
Method Description
Disseminated model MV4-11 cells (3x10 cells in 0.2 mL) were intravenously injected into the lateral tail vein of female NCG mice. Treatment (iv 3 mg/kg x1) was started thirteen days after tumor cell injection.
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD33 expression (CD33+++/++)
Method Description
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (iv, 3 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Revealed Based on the Cell Line Data
Click To Hide/Show 38 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
90 pM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia ML-2 cells CVCL_1418
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
90 pM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.11 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.2 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Myelodysplastic syndrome F-36P cells CVCL_2037
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.34 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia Kasumi-6 cells CVCL_0614
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.36 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.36 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia OCI-AML-4 cells CVCL_5224
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.43 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia AML-193 cells CVCL_1071
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.52 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Chronic eosinophilic leukemia EoL-1 cells CVCL_0258
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.61 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.01 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia HNT-34 cells CVCL_2071
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
11.2 nM
Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia Kasumi-3 cells CVCL_0612
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia GDM-1 cells CVCL_1230
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute erythroid leukemia TF-1a cells CVCL_3608
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Chronic myeloid leukemia KU812 cells CVCL_0379
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute megakaryoblastic leukemia CMK-11-5 cells CVCL_0217
Experiment 17 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Leukemia KOPN-8 cells CVCL_1866
Experiment 18 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia SKM-1 cells CVCL_0098
Experiment 19 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Leukemia ARH-77 cells CVCL_1072
Experiment 20 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 21 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Leukemia Jurkat E6.1 cells CVCL_0367
Experiment 22 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model B-lymphoblastic leukemia SUP-B15 cells CVCL_0103
Experiment 23 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model T lymphoblastic lymphoma SUP-T1 cells CVCL_1714
Experiment 24 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model T acute lymphoblastic leukemia ATN-1 cells CVCL_1073
Experiment 25 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult T acute lymphoblastic leukemia LOUCY cells CVCL_1380
Experiment 26 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model B acute lymphoblastic leukemia Reh cells CVCL_1650
Experiment 27 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model B acute lymphoblastic leukemia LC4-1 cells CVCL_1374
Experiment 28 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult T acute lymphoblastic leukemia MOLT-4 cells CVCL_0013
Experiment 29 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Childhood B acute lymphoblastic leukemia NALM-16 cells CVCL_1834
Experiment 30 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model T acute lymphoblastic leukemia TALL-1 cells CVCL_1736
Experiment 31 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model T acute lymphoblastic leukemia CCRF-CEM cells CVCL_0207
Experiment 32 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Negative CD33 expression (CD33-)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult B acute lymphoblastic leukemia RS4;11 cells CVCL_0093
Experiment 33 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia PLB-985 cells CVCL_2162
Experiment 34 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute myeloid leukemia OCI-M1 cells CVCL_2149
Experiment 35 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 36 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Acute monocytic leukemia NOMO-1 cells CVCL_1609
Experiment 37 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Leukemia KG-1a cells CVCL_1824
Experiment 38 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 20 nM Positive CD33 expression (CD33+++/++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Adult acute myeloid leukemia OCI-AML-1 cells CVCL_5228
Anti-CD33AB-Compound (Ib) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 57.39% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lb) was diluted with vehicle, which provided, 2.94 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.61% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lb) was diluted with vehicle, which provided, 2.94 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Anti-CD33AB-Compound (Ic) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 65.26% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lc) was diluted with vehicle, which provided, 3 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Anti-CD33AB-Compound (Ie) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 80.84% Positive CD33 expression (CD33+++/++)
Method Description
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (le) was diluted with vehicle, which provided, 2.83 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).

   Click to Show/Hide
In Vivo Model MV411 CDX model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
References
Ref 1 Neodegrader conjugates; 2021-10-07.