Antibody Information
General Information of This Antibody
| Antibody ID | ANI0NKKSX |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-CD33AB |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1 |
|||||
| Antigen Name | Myeloid cell surface antigen CD33 (CD33) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKKPGSSVKVSCKASGYTITDSNIHWVRQAPGQSLEWIGYIYPYNGGTDY
NQKFKNRATLTVDNPTNTAYMELSSLRSEDTAFYYCVNGNPWLAYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTVICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VESCSVMHEALHNHVTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQLTQSPSTLSASVGDRVTITCRASESLDNYGIRFLTWFQQKPGKAPKLLMYAASNQGS
GVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQTKEVPWSFGQGTKVEVKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-CD33AB-Compound (Ih) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 42.35% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lh) was diluted with vehicle, which provided, 2.99 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
Anti-CD33AB-Compound (Ia) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 56.31% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (QD, 1 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 71.16% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Disseminated model OCI-AML-2 cells (3x10 cells in 0.2 mL) were intravenously injected into the lateral tail vein of female NCG mice. Treatment (iv 3 mg/kg x1) was started thirteen days after tumor cell injection.
|
||||
| In Vivo Model | OCI-AML-2 CDX model | ||||
| In Vitro Model | Adult acute myeloid leukemia | OCI-AML-2 cells | CVCL_1619 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 86.75% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (la) was diluted with vehicle, which provided, 3.02 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.38% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (QD, 3 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.22% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (la) was diluted with vehicle, which provided, 3.02 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Disseminated model MV4-11 cells (3x10 cells in 0.2 mL) were intravenously injected into the lateral tail vein of female NCG mice. Treatment (iv 3 mg/kg x1) was started thirteen days after tumor cell injection.
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (iv, 3 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
90 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | ML-2 cells | CVCL_1418 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
90 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.11 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.2 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Myelodysplastic syndrome | F-36P cells | CVCL_2037 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.34 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.36 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.36 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-AML-4 cells | CVCL_5224 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.43 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | AML-193 cells | CVCL_1071 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.52 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Chronic eosinophilic leukemia | EoL-1 cells | CVCL_0258 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.61 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.01 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | HNT-34 cells | CVCL_2071 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
11.2 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | Kasumi-3 cells | CVCL_0612 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | GDM-1 cells | CVCL_1230 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute erythroid leukemia | TF-1a cells | CVCL_3608 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Chronic myeloid leukemia | KU812 cells | CVCL_0379 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | KOPN-8 cells | CVCL_1866 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | SKM-1 cells | CVCL_0098 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | ARH-77 cells | CVCL_1072 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | Jurkat E6.1 cells | CVCL_0367 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B-lymphoblastic leukemia | SUP-B15 cells | CVCL_0103 | ||
| Experiment 23 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T lymphoblastic lymphoma | SUP-T1 cells | CVCL_1714 | ||
| Experiment 24 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | ATN-1 cells | CVCL_1073 | ||
| Experiment 25 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult T acute lymphoblastic leukemia | LOUCY cells | CVCL_1380 | ||
| Experiment 26 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | Reh cells | CVCL_1650 | ||
| Experiment 27 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | LC4-1 cells | CVCL_1374 | ||
| Experiment 28 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult T acute lymphoblastic leukemia | MOLT-4 cells | CVCL_0013 | ||
| Experiment 29 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood B acute lymphoblastic leukemia | NALM-16 cells | CVCL_1834 | ||
| Experiment 30 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | TALL-1 cells | CVCL_1736 | ||
| Experiment 31 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | CCRF-CEM cells | CVCL_0207 | ||
| Experiment 32 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult B acute lymphoblastic leukemia | RS4;11 cells | CVCL_0093 | ||
| Experiment 33 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | PLB-985 cells | CVCL_2162 | ||
| Experiment 34 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 35 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 36 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute monocytic leukemia | NOMO-1 cells | CVCL_1609 | ||
| Experiment 37 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | KG-1a cells | CVCL_1824 | ||
| Experiment 38 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | OCI-AML-1 cells | CVCL_5228 | ||
Anti-CD33AB-Compound (Ib) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 57.39% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lb) was diluted with vehicle, which provided, 2.94 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.61% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lb) was diluted with vehicle, which provided, 2.94 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
Anti-CD33AB-Compound (Ic) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 65.26% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (lc) was diluted with vehicle, which provided, 3 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
Anti-CD33AB-Compound (Ie) [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 80.84% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
1 x 107 MV411 human acute monocytic leukemia cells in 50% Matrigel were injected subcutaneously in the flank of the mice (0.1 mL/mouse). The mice were dosed with anti-CD33 antibody-neoDegrader conjugates and vehicle control once tumors reached an average size of 100-150 mm3. The stock solutions of CD33AB-Compound (le) was diluted with vehicle, which provided, 2.83 mg/kg in a dosing volume of 10 mL/kg (0.2 mL per 20 g mouse).
Click to Show/Hide
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
