Antibody Information

General Information of This Antibody

Antibody ID	ANI0RIZHH
Antibody Name	Anti-CD33 mAb 15G15.33
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized IgG
Antigen Name	Myeloid cell surface antigen CD33 (CD33)	Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	QVQLVQSGAEVKKPGSSVKVSCKASGGIFSNHAISWVRQAPGQGLEWMGGIIPIFGTANY AQKFQGRVTITADESTSTAFMELSSLRSEDTAVYYCAREWADVFDIWGQGTMVTVSS Click to Show/Hide
Light Chain Sequence	EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGVNSV SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPWTFGQGTKVEIK Click to Show/Hide

Each Antibody-drug Conjugate Related to This Antibody

Full Information of The Activity Data of The ADC(s) Related to This Antibody

CD33 PNU ADC2-2 [Investigative]

ADC Info

Discovered Using Cell Line-derived Xenograft Model

Click To Hide/Show 2 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 63.30% (Day 14)	Positive CD33 expression (CD33+++/++)
Method Description	Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.4 mg/kg) that were administered once IV at the day 0 time point.
In Vivo Model	HL-60 CDX model
In Vitro Model	Adult acute myeloid leukemia	HL-60 cells		CVCL_0002
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 79.11% (Day 15)	Positive CD33 expression (CD33+++/++)
Method Description	Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.7 mg/kg) that were administered once IV at the day 0 time point.
In Vivo Model	HL-60 CDX model
In Vitro Model	Adult acute myeloid leukemia	HL-60 cells		CVCL_0002

Revealed Based on the Cell Line Data

Click To Hide/Show 1 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	6.90 ng/mL	Positive CD33 expression (CD33+++/++)
Method Description	The cells, at a predeterminedconcentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5CO₂, serialdilutions of each test article (TA) were added to the cells. Cells were incubated with test articlesfor 72 hours, and viability was detected with CellTiter-Glo reagent.
In Vitro Model	Chronic eosinophilic leukemia	EoL-1 cells		CVCL_0258

CD33 PNU ADC3-2 [Investigative]

ADC Info

Discovered Using Cell Line-derived Xenograft Model

Click To Hide/Show 2 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 76.69% (Day 15)	Positive CD33 expression (CD33+++/++)
Method Description	Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.2 mg/kg) that were administered once IV at the day 0 time point.
In Vivo Model	HL-60 CDX model
In Vitro Model	Adult acute myeloid leukemia	HL-60 cells		CVCL_0002
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 97.34% (Day 15)	Positive CD33 expression (CD33+++/++)
Method Description	Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.7 mg/kg) that were administered once IV at the day 0 time point.
In Vivo Model	HL-60 CDX model
In Vitro Model	Adult acute myeloid leukemia	HL-60 cells		CVCL_0002

Revealed Based on the Cell Line Data

Click To Hide/Show 1 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	2.00 ng/mL	Positive CD33 expression (CD33+++/++)
Method Description	The cells, at a predeterminedconcentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5CO₂, serialdilutions of each test article (TA) were added to the cells. Cells were incubated with test articlesfor 72 hours, and viability was detected with CellTiter-Glo reagent.
In Vitro Model	Chronic eosinophilic leukemia	EoL-1 cells		CVCL_0258

CD33 PNU ADC4-2 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 1 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.60 ng/mL	Positive CD33 expression (CD33+++/++)
Method Description	The cells, at a predeterminedconcentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5CO₂, serialdilutions of each test article (TA) were added to the cells. Cells were incubated with test articlesfor 72 hours, and viability was detected with CellTiter-Glo reagent.
In Vitro Model	Chronic eosinophilic leukemia	EoL-1 cells		CVCL_0258

References

Ref 1	Peptidomimetic compounds and antibody-drug conjugates thereof; 2015-09-03.