Antibody Information
General Information of This Antibody
| Antibody ID | ANI0AZCDK |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Gemtuzumab |
|||||
| Organization | Pfizer Inc. |
|||||
| Indication | Acute myeloid leukemia |
|||||
| Synonyms |
hP67.6
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG4-kappa |
|||||
| Antigen Name | Myeloid cell surface antigen CD33 (CD33) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKKPGSSVKVSCKASGYTITDSNIHWVRQAPGQSLEWIGYIYPYNGGTDY
NQKFKNRATLTVDNPTNTAYMELSSLRSEDTAFYYCVNGNPWLAYWGQGTLVTVSSASTK GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS CSVMHEALHNHYTQKSLSLSLGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQLTQSPSTLSASVGDRVTITCRASESLDNYGIRFLTWFQQKPGKAPKLLMYAASNQGS
GVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQTKEVPWSFGQGTKVEVKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Gemtuzumab ozogamicin [Approved in 2000 (withdrawn in 2010, approved again in 2017)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Two-year Overall Survival (OS) |
69.00 (standard group); 73.00 (gemtuzumab ozogamicin group) %
|
|||
| Patients Enrolled |
Eligible participants were 18 years or older and had newly diagnosed NPM1-mutated acute myeloid leukaemia and an Eastern Cooperative Oncology Group performance status of 0-2.
|
||||
| Administration Dosage |
Participants received two cycles of induction therapy plus all-trans retinoic acid (ATRA) followed by three consolidation cycles of high-dose cytarabine and ATRA, without or with gemtuzumab ozogamicin (3 mg/m2 i.v.on day 1 of induction cycles 1 and 2, and consolidation cycle 1).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00893399 | Clinical Status | Phase 3 | ||
| Clinical Description |
Phase III study of chemotherapy in combination with atra with or without gemtuzumab ozogamicin in patients with acute myeloid leukemia and npm1 gene mutation.
|
||||
| Primary Endpoint |
Short-term event-free survival at 6-month follow-up, 53.00% in the standard group and 58.00% in the gemtuzumab ozogamicin group.
|
||||
| Other Endpoint |
CRi rates, n=267 (90%) in the standard group vs n=251 (86%) in the gemtuzumab ozogamicin group.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
85%
|
Positive CD33 expression (CD33+++/++) | ||
| Patients Enrolled |
Previously untreated primary or secondary acute myeloid leukemia (with bone marrow blasts 20%), express CD33 on blast cells.
|
||||
| Administration Dosage |
3 mg/sqm single dose on day 6.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00909168 | Clinical Status | Phase 3 | ||
| Clinical Description |
Induction, consolidation and intensification therapy for patients younger than 66 years with previously untreated CD33 positive acute myeloid leukemia (AML) (MYFLAI07).
|
||||
| Primary Endpoint |
Objective response rate=85.00%, comprising 82.00% complete responses and 3.00% partial responses.
|
||||
| Other Endpoint |
median DFS=61 months, median OS=63 months.
|
||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 13.81% | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Subcutaneous tumor model MV4-11 human acute myelocytic leukemia cells (1x10 cells in 0.1 mL) were subcutaneously inoculated into the right flank of female athymic nude mice. Mice were treated with ADCs (iv, 0.1 mg/kg x 1) when tumors reached 150 mm3 and mouse body weight were measured twice per week.
|
||||
| In Vivo Model | MV411 CDX model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
20 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | ML-2 cells | CVCL_1418 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
30 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Chronic eosinophilic leukemia | EoL-1 cells | CVCL_0258 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
30 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
40 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
70 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
90 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | OCI-AML-1 cells | CVCL_5228 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
90 pM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | AML-193 cells | CVCL_1071 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-AML-4 cells | CVCL_5224 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 0.41 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | KOPN-8 cells | CVCL_1866 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.43 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult T acute lymphoblastic leukemia | MOLT-4 cells | CVCL_0013 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.45 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | SKM-1 cells | CVCL_0098 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.52 nM
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | HNT-34 cells | CVCL_2071 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.56 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult B acute lymphoblastic leukemia | RS4;11 cells | CVCL_0093 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.58 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | Reh cells | CVCL_1650 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.47 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | LC4-1 cells | CVCL_1374 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.78 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | B-lymphoblastic leukemia | SUP-B15 cells | CVCL_0103 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.57 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.92 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | TALL-1 cells | CVCL_1736 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.31 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult T acute lymphoblastic leukemia | LOUCY cells | CVCL_1380 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.02 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Childhood B acute lymphoblastic leukemia | NALM-16 cells | CVCL_1834 | ||
| Experiment 23 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.03 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | ATN-1 cells | CVCL_1073 | ||
| Experiment 24 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.56 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | CCRF-CEM cells | CVCL_0207 | ||
| Experiment 25 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.61 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | T lymphoblastic lymphoma | SUP-T1 cells | CVCL_1714 | ||
| Experiment 26 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.91 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | ARH-77 cells | CVCL_1072 | ||
| Experiment 27 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
10.2 nM
|
Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | Jurkat E6.1 cells | CVCL_0367 | ||
| Experiment 28 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | GDM-1 cells | CVCL_1230 | ||
| Experiment 29 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute erythroid leukemia | TF-1a cells | CVCL_3608 | ||
| Experiment 30 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Chronic myeloid leukemia | KU812 cells | CVCL_0379 | ||
| Experiment 31 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Negative CD33 expression (CD33-) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 32 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | PLB-985 cells | CVCL_2162 | ||
| Experiment 33 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 34 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 35 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute monocytic leukemia | NOMO-1 cells | CVCL_1609 | ||
| Experiment 36 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Leukemia | KG-1a cells | CVCL_1824 | ||
| Experiment 37 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | Kasumi-3 cells | CVCL_0612 | ||
| Experiment 38 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | AML-193 cells | CVCL_1071 | ||
| Experiment 39 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 40 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 20 nM | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Myelodysplastic syndrome | F-36P cells | CVCL_2037 | ||
BL-M11D1 [Phase 2/3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
14.3
42.9 50 % |
|||
| Patients Enrolled |
Eligible patients (18-75 years) have relapsed/refractory AML, ECOG ≤2, and adequate organ function. Exclusions include prior transplants, heart/lung conditions (e.g., QT prolongation, ILD), HIV/HBV/HCV infections, uncontrolled hypertension, autoimmune diseases, recent chemotherapy (<4 weeks), or pregnancy. Investigators may exclude unsuitable candidates.
Click to Show/Hide
|
||||
| Administration Dosage |
This study enrolled patients with R/R AML aged 18-75 years. For dose escalation (D-ESC i3+3), BL-M11D1 was administrated intravenously in dose cohorts from 0.6mg/kg up to 4.4mg/kg once a week (QW) in 28-day cycles for induction treatment, followed by administration every two weeks (Q2W) at the same initial dose for consolidation treatment in pts whose bone marrow (BM) blast <5%. A subset of pts were enrolled in dose-expansion (D-EXP) at 1.65, 2.2 mg/kg doses.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05924750 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Clinical Trial to Evaluate the Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of BL-M11D1 in Relapsed/Refractory Acute Myeloid Leukemia (AML) Patients
|
||||
| Primary Endpoint |
Phase Ia evaluates BL-M11D1's Dose-Limiting Toxicity (DLT) and Maximum Tolerated Dose (MTD) within 28 days post-first dose, assessed via NCI-CTCAE v5.0. The RP2D for Phase Ib is determined based on safety, efficacy, PK, and PD data.
|
||||
| Other Endpoint |
Safety measures include Treatment-Emergent Adverse Events (TEAEs) over ~24 months and pharmacokinetic parameters (Cmax, Tmax, T1/2, AUC0-t, CL, Ctrough) within 28 days. Efficacy endpoints explore ORR (CR/PR per RECIST 1.1), DCR (CR/PR/SD), and DOR (~24 months). Immunogenicity (ADA) is monitored throughout.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible patients (≥18 years) have relapsed/refractory CD33+ AML, ECOG 0-2, adequate organ function, and life expectancy ≥3 months. Exclusions include APL/CML, recent chemotherapy (<2 weeks/5 half-lives), uncontrolled heart disease, active infections, severe lung conditions (ILD), CNS leukemia, pregnancy, or conditions deemed unsafe by investigators. HIV/HBV/HCV-positive patients with detectable viral loads are excluded.
Click to Show/Hide
|
||||
| Administration Dosage |
BL-M11D1 will be administered on Day 1 by intravenous infusion every 28 days.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06714591 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Multicenter, Open-Label Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetic Profile, and Preliminary Efficacy of BL-M11D1 in Patients with Relapsed/Refractory Acute Myeloid Leukemia.
|
||||
| Primary Endpoint |
The study evaluates BL-M11D1 safety by monitoring dose-limiting toxicities (DLTs) including severe TEAEs (≥Grade 3), treatment discontinuation events, and hematologic/nonhematologic toxicities over 1 year. Key safety endpoints include determining the maximum tolerated dose (MTD), minimum safe and effective dose (MSED), and assessing serious adverse events (SAEs).
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Cmax, Tmax, AUC) for BL-M11D1, free payload ED-04, and anti-CD33 antibodies are measured over 1 year. Efficacy is assessed via ORR, DOR (RECIST 1.1), and AML response criteria (CR, CRh, CRi, MRD status, MLFS, PR per ELN 2022 guidelines).
|
||||
References
