Antigen ID	TAR0EBTXG
Antigen Name	B-lymphocyte antigen CD19 (CD19)
Gene Name	CD19
Gene ID	930
Synonym	B-lymphocyte surface antigen B4; Differentiation antigen CD19;T-cell surface antigen Leu-12;CD_antigen=CD19
Sequence	MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR     Click to Show/Hide
Function	Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge.     Click to Show/Hide
Uniprot Entry	CD19_HUMAN
HGNC ID	HGNC:1633
KEGG ID	hsa:930

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AFM-11-2i	Monomethyl auristatin F	Microtubule (MT)	AFM-11-2i linker	[1]
ADC Info	AFM-11-4i	Monomethyl auristatin F	Microtubule (MT)	AFM-11-4i linker	[1]
ADC Info	AFM-11-3i	Monomethyl auristatin F	Microtubule (MT)	AFM-11-3i linker	[1]
ADC Info	AFM-11-6e	Monomethyl auristatin E	Microtubule (MT)	AFM-11-6e linker	[1]
ADC Info	AFM-11-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	AFM-11-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AFM-12-2i	Monomethyl auristatin F	Microtubule (MT)	AFM-12-2i linker	[1]
ADC Info	AFM-12-4i	Monomethyl auristatin F	Microtubule (MT)	AFM-12-4i linker	[1]
ADC Info	AFM-12-3i	Monomethyl auristatin F	Microtubule (MT)	AFM-12-3i linker	[1]
ADC Info	AFM-12-6e	Monomethyl auristatin E	Microtubule (MT)	AFM-12-6e linker	[1]
ADC Info	AFM-12-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	AFM-12-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ABBV-319	Proprietary GRM agonist	Glucocorticoid receptor (NR3C1)	Formyl-Ala-Ala	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	B4-SPP-DC44	DC44	Human Deoxyribonucleic acid (hDNA)	N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)	[3]
ADC Info	B4-SMCC-DC4	Phosphate prodrugs 40 (DC4)	Human Deoxyribonucleic acid (hDNA)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)	[3]
ADC Info	B4-SPP-DC4	Phosphate prodrugs 40 (DC4)	Human Deoxyribonucleic acid (hDNA)	N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)	[3]
ADC Info	B4-SPP-DC1	DC1	Human Deoxyribonucleic acid (hDNA)	N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LCB14-0648	Monomethyl auristatin F	Microtubule (MT)	LCB14-0648 linker	[1]
ADC Info	LCB14-0663	Monomethyl auristatin F	Microtubule (MT)	LCB14-0663 linker	[1]
ADC Info	LCB14-0664	Monomethyl auristatin F	Microtubule (MT)	LCB14-0664 linker	[1]
ADC Info	LCB14-6e	Monomethyl auristatin E	Microtubule (MT)	LCB14-6e linker	[1]
ADC Info	WO2017089895A1 ADC67	Monomethyl auristatin F	Microtubule (MT)	WO2017089895A1_ADC67 linker	[4]
ADC Info	WO2017089895A1 ADC68	Monomethyl auristatin E	Microtubule (MT)	WO2017089895A1_ADC68 linker	[4]
ADC Info	WO2017089895A1 ADC69	Monomethyl auristatin F	Microtubule (MT)	WO2017089895A1_ADC69 linker	[4]
ADC Info	LCB14-alpha-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	LCB14-alpha-amanitin linker	[1]
ADC Info	WO2017089890A1 ADC67	Monomethyl auristatin F	Microtubule (MT)	WO2017089890A1_ADC67 linker	[5]
ADC Info	WO2017089890A1 ADC68	Monomethyl auristatin E	Microtubule (MT)	WO2017089890A1_ADC68 linker	[5]
ADC Info	WO2017089890A1 ADC69	Monomethyl auristatin F	Microtubule (MT)	WO2017089890A1_ADC69 linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HA19-SN38 antibody-drug conjugate	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	hBU12-mc-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SGN-CD19B	SGD-1882	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Ala	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	cHD37-2i	Monomethyl auristatin F	Microtubule (MT)	cHD37-2i linker	[1]
ADC Info	cHD37-4i	Monomethyl auristatin F	Microtubule (MT)	cHD37-4i linker	[1]
ADC Info	cHD37-3i	Monomethyl auristatin F	Microtubule (MT)	cHD37-3i linker	[1]
ADC Info	cHD37-6e	Monomethyl auristatin E	Microtubule (MT)	cHD37-6e linker	[1]
ADC Info	cHD37-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	cHD37-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Coltuximab ravtansine	Mertansine DM4	Microtubule (MT)	N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Denintuzumab-2i	Monomethyl auristatin F	Microtubule (MT)	Denintuzumab-2i linker	[1]
ADC Info	Denintuzumab-4i	Monomethyl auristatin F	Microtubule (MT)	Denintuzumab-4i linker	[1]
ADC Info	Denintuzumab-3i	Monomethyl auristatin F	Microtubule (MT)	Denintuzumab-3i linker	[1]
ADC Info	Denintuzumab-6e	Monomethyl auristatin E	Microtubule (MT)	Denintuzumab-6e linker	[1]
ADC Info	Denintuzumab-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Denintuzumab-amanitin linker	[1]
ADC Info	hBU12-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[10]
ADC Info	hBU12-MC-vc-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]
ADC Info	hBU12-MC-vc-PABC-MMAF DAR4	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]
ADC Info	hBU12-1 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Dpr-MA	[10]
ADC Info	hBU12-1 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Dpr-MA	[10]
ADC Info	hBU12-2 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MA	[10]
ADC Info	hBU12-2 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MA	[10]
ADC Info	hBU12-3 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Dpr-MA	[10]
ADC Info	hBU12-3 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Dpr-MA	[10]
ADC Info	hBU12-4 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MA	[10]
ADC Info	hBU12-4 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MA	[10]
ADC Info	hBU12-5 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-5 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-6 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-6 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-7 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Lys-MDpr	[10]
ADC Info	hBU12-7 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Lys-MDpr	[10]
ADC Info	hBU12-8 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-Lys-MDpr	[10]
ADC Info	hBU12-9 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-EDA-MDpr	[10]
ADC Info	hBU12-10 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-EDA-MDpr	[10]
ADC Info	hBU12-11 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-EDA-MDpr	[10]
ADC Info	hBU12-12 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Ile-EDA-MDpr	[10]
ADC Info	hBU12-13 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[10]
ADC Info	hBU12-14 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-Ala-Lys-MDpr	[10]
ADC Info	hBU12-15 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Lys-MDpr	[10]
ADC Info	hBU12-16 MMAE	Monomethyl auristatin E	Microtubule (MT)	PhosphoThr-Ala-Lys-MDpr	[10]
ADC Info	hBU12-17 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-18 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-19 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-20 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-21 MMAE	Monomethyl auristatin E	Microtubule (MT)	hSer-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-22 MMAE	Monomethyl auristatin E	Microtubule (MT)	ValoH-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-23 MMAE	Monomethyl auristatin E	Microtubule (MT)	PhosphoThr-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-24 MMAE	Monomethyl auristatin E	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-25 MMAE	Monomethyl auristatin E	Microtubule (MT)	Triazole-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-26 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asn-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-27 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-28 MMAE	Monomethyl auristatin E	Microtubule (MT)	Fur-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-29 MMAE	Monomethyl auristatin E	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-30 MMAE	Monomethyl auristatin E	Microtubule (MT)	Ser-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-31 MMAE	Monomethyl auristatin E	Microtubule (MT)	hSer-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-32 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-IleLeu-Dpr-MDpr	[10]
ADC Info	hBU12-33 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-Leu-Dpr-MDpr	[10]
ADC Info	hBU12-34 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Phe-Leu-Dpr-MDpr	[10]
ADC Info	hBU12-35 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-LeuPhe-Dpr-MDpr	[10]
ADC Info	hBU12-36 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Leu-Phe-Dpr-MDpr	[10]
ADC Info	hBU12-37 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Phe-Phe-Dpr-MDpr	[10]
ADC Info	hBU12-38 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-LysAla-Dpr-MDpr	[10]
ADC Info	hBU12-39 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-Lys-Dpr-MDpr	[10]
ADC Info	hBU12-1 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Dpr-MA	[10]
ADC Info	hBU12-2 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-Dpr-MA	[10]
ADC Info	hBU12-3 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Dpr-MA	[10]
ADC Info	hBU12-4 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Dpr-MA	[10]
ADC Info	hBU12-5 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-6 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-7 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Lys-MDpr	[10]
ADC Info	hBU12-8 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thiazole-Glu-Lys-MDpr	[10]
ADC Info	hBU12-9 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-EDA-MDpr	[10]
ADC Info	hBU12-10 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-EDA-MDpr	[10]
ADC Info	hBU12-11 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Ile-EDA-MDpr	[10]
ADC Info	hBU12-12 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Ile-EDA-MDpr	[10]
ADC Info	hBU12-13 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[10]
ADC Info	hBU12-14 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-Ala-Lys-MDpr	[10]
ADC Info	hBU12-15 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Lys-MDpr	[10]
ADC Info	hBU12-16 MMAF	Monomethyl auristatin F	Microtubule (MT)	PhosphoThr-Ala-Lys-MDpr	[10]
ADC Info	hBU12-17 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-18 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-19 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-20 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-21 MMAF	Monomethyl auristatin F	Microtubule (MT)	hSer-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-22 MMAF	Monomethyl auristatin F	Microtubule (MT)	ValoH-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-23 MMAF	Monomethyl auristatin F	Microtubule (MT)	PhosphoThr-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-24 MMAF	Monomethyl auristatin F	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-25 MMAF	Monomethyl auristatin F	Microtubule (MT)	Triazole-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-26 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asn-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-27 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-28 MMAF	Monomethyl auristatin F	Microtubule (MT)	Fur-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-29 MMAF	Monomethyl auristatin F	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-30 MMAF	Monomethyl auristatin F	Microtubule (MT)	Ser-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-31 MMAF	Monomethyl auristatin F	Microtubule (MT)	hSer-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-32 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-IleLeu-Dpr-MDpr	[10]
ADC Info	hBU12-33 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Ile-Leu-Dpr-MDpr	[10]
ADC Info	hBU12-34 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Phe-Leu-Dpr-MDpr	[10]
ADC Info	hBU12-35 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-LeuPhe-Dpr-MDpr	[10]
ADC Info	hBU12-36 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Leu-Phe-Dpr-MDpr	[10]
ADC Info	hBU12-37 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Phe-Phe-Dpr-MDpr	[10]
ADC Info	hBU12-38 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-LysAla-Dpr-MDpr	[10]
ADC Info	hBU12-39 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Lys-Dpr-MDpr	[10]
ADC Info	hBU12-MC-vc-PABC-MMAF DAR8	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]
ADC Info	hBU12-13 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[10]
ADC Info	hBU12-12 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Ile-EDA-MDpr	[10]
ADC Info	hBU12-11 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-EDA-MDpr	[10]
ADC Info	hBU12-17 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[10]
ADC Info	hBU12-20 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-24 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[10]
ADC Info	hBU12-29 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD19(LC)-G7VIM-2i	Monomethyl auristatin F	Microtubule (MT)	Anti-CD19(LC)-G7VIM-2i linker	[1]
ADC Info	Anti-CD19(LC)-G7VIM-4i	Monomethyl auristatin F	Microtubule (MT)	Anti-CD19(LC)-G7VIM-4i linker	[1]
ADC Info	Anti-CD19(LC)-G7VIM-3i	Monomethyl auristatin F	Microtubule (MT)	Anti-CD19(LC)-G7VIM-3i linker	[1]
ADC Info	Anti-CD19(LC)-G7VIM-6e	Monomethyl auristatin E	Microtubule (MT)	Anti-CD19(LC)-G7VIM-6e linker	[1]
ADC Info	Anti-CD19(LC)-G7VIM-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Anti-CD19(LC)-G7VIM-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	GBR401-2i	Monomethyl auristatin F	Microtubule (MT)	GBR401-2i linker	[1]
ADC Info	GBR401-4i	Monomethyl auristatin F	Microtubule (MT)	GBR401-4i linker	[1]
ADC Info	GBR401-3i	Monomethyl auristatin F	Microtubule (MT)	GBR401-3i linker	[1]
ADC Info	GBR401-6e	Monomethyl auristatin E	Microtubule (MT)	GBR401-6e linker	[1]
ADC Info	GBR401-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	GBR401-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Inebilizumab-2i	Monomethyl auristatin F	Microtubule (MT)	Inebilizumab-2i linker	[1]
ADC Info	Inebilizumab-4i	Monomethyl auristatin F	Microtubule (MT)	Inebilizumab-4i linker	[1]
ADC Info	Inebilizumab-3i	Monomethyl auristatin F	Microtubule (MT)	Inebilizumab-3i linker	[1]
ADC Info	Inebilizumab-6e	Monomethyl auristatin E	Microtubule (MT)	Inebilizumab-6e linker	[1]
ADC Info	Inebilizumab-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Inebilizumab-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Loncastuximab tesirine	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MDX-1342-2i	Monomethyl auristatin F	Microtubule (MT)	MDX-1342-2i linker	[1]
ADC Info	MDX-1342-4i	Monomethyl auristatin F	Microtubule (MT)	MDX-1342-4i linker	[1]
ADC Info	MDX-1342-3i	Monomethyl auristatin F	Microtubule (MT)	MDX-1342-3i linker	[1]
ADC Info	MDX-1342-6e	Monomethyl auristatin E	Microtubule (MT)	MDX-1342-6e linker	[1]
ADC Info	MDX-1342-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	MDX-1342-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MDX-1435-2i	Monomethyl auristatin F	Microtubule (MT)	MDX-1435-2i linker	[1]
ADC Info	MDX-1435-4i	Monomethyl auristatin F	Microtubule (MT)	MDX-1435-4i linker	[1]
ADC Info	MDX-1435-3i	Monomethyl auristatin F	Microtubule (MT)	MDX-1435-3i linker	[1]
ADC Info	MDX-1435-6e	Monomethyl auristatin E	Microtubule (MT)	MDX-1435-6e linker	[1]
ADC Info	MDX-1435-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	MDX-1435-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Obexelimab-2i	Monomethyl auristatin F	Microtubule (MT)	Obexelimab-2i linker	[1]
ADC Info	Obexelimab-4i	Monomethyl auristatin F	Microtubule (MT)	Obexelimab-4i linker	[1]
ADC Info	Obexelimab-3i	Monomethyl auristatin F	Microtubule (MT)	Obexelimab-3i linker	[1]
ADC Info	Obexelimab-6e	Monomethyl auristatin E	Microtubule (MT)	Obexelimab-6e linker	[1]
ADC Info	Obexelimab-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Obexelimab-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RC58-ADC-1	Dumycin-7	Human Deoxyribonucleic acid (hDNA)	Bis-bromine linker-PEG4-Asn-Ala-ethylenediamine	[12]
ADC Info	RC58-ADC-3	Duostain 3	Undisclosed	Bis-bromine linker-mono-glycine-PEG12-PAB	[12]
ADC Info	RC58-ADC-2	Duostain 3	Undisclosed	Bis-bromine linker-PEG2-VC-PAB	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Tafasitamab-2i	Monomethyl auristatin F	Microtubule (MT)	Tafasitamab-2i linker	[1]
ADC Info	Tafasitamab-4i	Monomethyl auristatin F	Microtubule (MT)	Tafasitamab-4i linker	[1]
ADC Info	Tafasitamab-3i	Monomethyl auristatin F	Microtubule (MT)	Tafasitamab-3i linker	[1]
ADC Info	Tafasitamab-6e	Monomethyl auristatin E	Microtubule (MT)	Tafasitamab-6e linker	[1]
ADC Info	Tafasitamab-amanitin	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Tafasitamab-amanitin linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	IKS-03	Undisclosed	Undisclosed	Undisclosed	[13]
ADC Info	LCB-73	Undisclosed	Undisclosed	Undisclosed	[14]
ADC Info	HuB4-DGN462	DGN462	Human Deoxyribonucleic acid (hDNA)	Sulfo-SPDB	[15]
ADC Info	CD19-ATAC	HDP 30.2115	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mal-Val-Ala-PAB	[16]
ADC Info	NI-2201	Undisclosed	Undisclosed	Undisclosed	[17]
ADC Info	Anti-B4 monoclonal antibody-DC1 conjugate	DC1	Human Deoxyribonucleic acid (hDNA)	Undisclosed	[18]
ADC Info	NV102	Doxorubicin	DNA topoisomerase 2-alpha (TOP2A)	Undisclosed	[19]
ADC Info	CO-1008	Undisclosed	Undisclosed	Undisclosed	[20]
ADC Info	Denintuzumab mafodotin	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[21]
ADC Info	TE-1522	Undisclosed	Undisclosed	Undisclosed	[22]
ADC Info	Anti-CD19 monoclonal antibody-liposomal sodium butyrate conjugate	Sodium butyrate	Histone deacetylase 1 (HDAC1)	Undisclosed	[23]
ADC Info	B cell High Density Microparticles	Undisclosed	Undisclosed	Undisclosed	[24]
ADC Info	Monoclonal antibody B43-genistein-conjugate	Genistein	Pro-epidermal growth factor (EGF)	Undisclosed	[25]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.16E-25; Fold-change: 1.410147221; Z-score: 2.228067582
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.293573004; Fold-change: -0.226021531; Z-score: -1.290021358
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000258934; Fold-change: -0.608737311; Z-score: -1.438800272
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002467981; Fold-change: -1.046382672; Z-score: -1.693610121
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.99E-06; Fold-change: -0.06162536; Z-score: -0.18087815
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.09E-06; Fold-change: -0.343323727; Z-score: -1.41808629
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002728065; Fold-change: -0.542599714; Z-score: -2.179433787
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.74E-16; Fold-change: -2.029114238; Z-score: -3.154547976
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.103656715; Fold-change: -1.872357634; Z-score: -1.393804248
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.597531584; Fold-change: 0.047577441; Z-score: 0.132440793
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.35676261; Fold-change: -0.647084127; Z-score: -0.760166801
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.016729513; Fold-change: -0.99175493; Z-score: -0.787439603
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-27; Fold-change: -0.772796476; Z-score: -1.01995821
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.47E-12; Fold-change: -0.477047033; Z-score: -0.601726604
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.542182361; Fold-change: 0.081496426; Z-score: 0.044171098
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.14099629; Fold-change: -0.139788941; Z-score: -0.106042092
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.177967209; Fold-change: -0.21540781; Z-score: -0.693039757
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003655998; Fold-change: -0.150391206; Z-score: -0.349341419
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.980096618; Fold-change: -0.040088022; Z-score: -0.168969846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.00E-21; Fold-change: 0.617730858; Z-score: 0.869906041
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.07E-16; Fold-change: 0.487655803; Z-score: 0.718725508
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005519727; Fold-change: 0.518951495; Z-score: 0.700209979
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.72E-29; Fold-change: -0.362071583; Z-score: -1.278107683
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.038138187; Fold-change: -0.596862307; Z-score: -2.325438952
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.86E-38; Fold-change: 0.268944309; Z-score: 0.723584436
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.016287387; Fold-change: 0.046542313; Z-score: 0.084502389
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.863374041; Fold-change: 0.000213001; Z-score: 0.000876527
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000430241; Fold-change: 0.236464292; Z-score: 0.918868947
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.125139618; Fold-change: 0.107389446; Z-score: 0.342270949
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.32E-05; Fold-change: 0.082716018; Z-score: 0.224919992
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.018240837; Fold-change: 0.585182031; Z-score: 1.366454093
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000643964; Fold-change: -0.840331812; Z-score: -0.820421863
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031512276; Fold-change: 0.357477486; Z-score: 0.740050348
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.567686869; Fold-change: -0.422983557; Z-score: -2.53900995
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018221177; Fold-change: 0.030367127; Z-score: 0.017986172
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.684669247; Fold-change: 0.064745747; Z-score: 0.055214027
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.074839655; Fold-change: -0.121720122; Z-score: -0.75919934
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.631008965; Fold-change: 0.140762475; Z-score: 0.105447589
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.172801108; Fold-change: 0.142846221; Z-score: 0.588452776
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036142011; Fold-change: 0.1391758; Z-score: 0.44683408
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.44559903; Fold-change: 0.727544422; Z-score: 0.495745543
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021959257; Fold-change: -0.280993795; Z-score: -0.223740041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.849165417; Fold-change: 0.009913974; Z-score: 0.077679582
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000212844; Fold-change: -0.758172162; Z-score: -1.43849846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.798444383; Fold-change: -0.007052483; Z-score: -0.032304068
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.460708469; Fold-change: 0.082345968; Z-score: 0.793464718
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.330847637; Fold-change: -0.107639501; Z-score: -0.185123903
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.302687519; Fold-change: -0.03575179; Z-score: -0.177501537
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.87E-09; Fold-change: -1.202761109; Z-score: -2.014806056
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.950168363; Fold-change: -0.33389947; Z-score: -0.432496316
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.187793631; Fold-change: -0.026251958; Z-score: -0.091497819
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010508608; Fold-change: 0.78631082; Z-score: 4.103354421
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.632975184; Fold-change: -0.347636404; Z-score: -0.468850856
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.58E-11; Fold-change: -0.790430064; Z-score: -1.124258106
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.29E-29; Fold-change: -0.746671047; Z-score: -1.263006838
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024137949; Fold-change: -0.350831575; Z-score: -0.735351427
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.261228119; Fold-change: -1.054481209; Z-score: -10.54689768
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.844663494; Fold-change: 0.056164438; Z-score: 0.064037889
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200945483; Fold-change: -0.558090581; Z-score: -0.599421927
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.149694747; Fold-change: 0.087459823; Z-score: 0.578139416
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.205250995; Fold-change: -0.255802212; Z-score: -0.701870618
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.255524704; Fold-change: 0.218279118; Z-score: 0.701359308
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.219754714; Fold-change: 0.028692585; Z-score: 0.346913397
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.153197207; Fold-change: 2.635954591; Z-score: 7.589246911
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.529858726; Fold-change: -0.460972039; Z-score: -0.928468608
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.156561014; Fold-change: 0.199657374; Z-score: 1.512898194
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.741936726; Fold-change: 0.090273878; Z-score: 0.166244675
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.520452716; Fold-change: 0.032009978; Z-score: 0.136440017
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.049596063; Fold-change: 0.166926113; Z-score: 0.179644725
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.466133351; Fold-change: -0.140115629; Z-score: -0.306750224
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014384669; Fold-change: 0.289016178; Z-score: 1.340521578
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.31E-19; Fold-change: 1.256173632; Z-score: 1.99635053
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.225972021; Fold-change: 0.146139245; Z-score: 0.828675724
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.37E-05; Fold-change: 1.163260039; Z-score: 2.855390447
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.85E-07; Fold-change: 0.941311897; Z-score: 2.017070851
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.100570905; Fold-change: 0.083680268; Z-score: 0.099594296
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000175039; Fold-change: 0.14314738; Z-score: 0.807939772
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.13E-11; Fold-change: -0.366465387; Z-score: -0.814733281
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.93E-47; Fold-change: 0.950053141; Z-score: 4.350653401
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054711153; Fold-change: -0.210765078; Z-score: -1.337694455
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.019224825; Fold-change: 0.148908678; Z-score: 0.465552236
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.561991309; Fold-change: -0.052672575; Z-score: -0.505945982
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387810634; Fold-change: 0.27729675; Z-score: 1.059911864
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.648829517; Fold-change: -0.163947961; Z-score: -0.360892597
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000964258; Fold-change: -0.547763174; Z-score: -0.764909816
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002878413; Fold-change: 0.427047639; Z-score: 1.495429157
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.656121196; Fold-change: -0.071303866; Z-score: -0.347040994
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.23620727; Fold-change: 0.145547186; Z-score: 1.589141961
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001386995; Fold-change: 0.216908021; Z-score: 0.780090592
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.97E-06; Fold-change: 2.942662131; Z-score: 4.981091248
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.985559691; Fold-change: -0.07000865; Z-score: -0.464279952
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.33E-24; Fold-change: -1.060235455; Z-score: -1.328624264
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.33E-07; Fold-change: -1.903622593; Z-score: -6.638832944
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.769255144; Fold-change: -0.064173239; Z-score: -0.492409928
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.10880601; Fold-change: -0.17621574; Z-score: -0.161392812
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001971873; Fold-change: -0.286337053; Z-score: -0.465272225
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.0321341; Fold-change: -1.054852221; Z-score: -1.726404061
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053092761; Fold-change: -0.425775827; Z-score: -0.784271069
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010037528; Fold-change: -0.702635773; Z-score: -1.536322361
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030733062; Fold-change: -0.074759144; Z-score: -0.144028895
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.43E-44; Fold-change: 1.059179166; Z-score: 2.076173698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00127383; Fold-change: -0.470668701; Z-score: -1.818670547
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.53E-06; Fold-change: -0.54615426; Z-score: -1.113810358
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.17265883; Fold-change: -0.051406948; Z-score: -0.187640742
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031836224; Fold-change: 0.25959497; Z-score: 2.416902672
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.106084597; Fold-change: 0.313503327; Z-score: 1.170497322
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.029467644; Fold-change: -1.215320629; Z-score: -1.360636451
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.064895305; Fold-change: 0.169353682; Z-score: 0.401719603
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.393586267; Fold-change: 0.042927355; Z-score: 0.178131279
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.92E-06; Fold-change: -1.221193588; Z-score: -2.647070825
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.973418287; Fold-change: -0.305795082; Z-score: -0.718821281
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.472074041; Fold-change: 0.001470757; Z-score: 0.00429712
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.237639419; Fold-change: -0.380216791; Z-score: -0.68393196
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.97312428; Fold-change: -0.014543534; Z-score: -0.050524802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010689341; Fold-change: -0.162202779; Z-score: -1.38390897
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.212762766; Fold-change: 0.085840461; Z-score: 0.858272868
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.984325688; Fold-change: -0.048450065; Z-score: -0.200569127
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.994712465; Fold-change: -0.002854789; Z-score: -0.02053996
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.668725266; Fold-change: 0.4919918; Z-score: 0.978187271
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.670266727; Fold-change: 0.075676469; Z-score: 0.189895766
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.060500552; Fold-change: -0.238045973; Z-score: -0.352929582
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.934625426; Fold-change: 0.039980775; Z-score: 0.189953988
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387594552; Fold-change: 0.045250742; Z-score: 0.065909399
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.165107387; Fold-change: 0.026740908; Z-score: 0.15034813
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.87089754; Fold-change: 0.031386688; Z-score: 0.032399444
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.602509835; Fold-change: 0.026374548; Z-score: 0.136984142
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.115374274; Fold-change: 0.154889127; Z-score: 0.975822215
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.241314292; Fold-change: 0.024464764; Z-score: 0.082565212
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.995986682; Fold-change: -0.110648502; Z-score: -0.402953848
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Compositions and methods related to anti-cd19 antibody drug conjugates; 2017-03-30.
Ref 2	A First-in-Human Phase 1 Study of Abbv-319, an Antibody-Drug Conjugate Composed of a CD19 Antibody Linked to a Potent Proprietary Glucocorticoid Receptor Modulator, in Patients with Relapsed or Refractory B-Cell Malignancies. Blood (2022) 140 (Supplement 1): 3746-3747. doi: 10.1182/blood-2022-166809.
Ref 3	Synthesis and biological evaluation of antibody conjugates of phosphate prodrugs of cytotoxic DNA alkylators for the targeted treatment of cancer. J Med Chem. 2012 Jan 26;55(2):766-82.
Ref 4	Antibody-drug conjugates comprising branched linkers and methods related thereto; 2017-06-01.
Ref 5	Conjugates comprising self-immolative groups and methods related thereto.
Ref 6	Introduction to basic information on ADC drug hA19-SN-38 antibody-drug conjugate - Immunomedics.
Ref 7	A coiled-coil masking domain for selective activation of therapeutic antibodies. Nat Biotechnol. 2019 Jul;37(7):761-765. doi: 10.1038/s41587-019-0135-x. Epub 2019 May 27.
Ref 8	Therapeutic potential of SGN-CD19B, a PBD-based anti-CD19 drug conjugate, for treatment of B-cell malignancies. Blood. 2017 Nov 2;130(18):2018-2026. doi: 10.1182/blood-2017-04-779389. Epub 2017 Sep 13.
Ref 9	A phase II, single-arm, multicentre study of coltuximab ravtansine (SAR3419) and rituximab in patients with relapsed or refractory diffuse large B-cell lymphoma. Br J Haematol. 2016 Jun;173(5):722-30. doi: 10.1111/bjh.13992.
Ref 10	Hydrophilic antibody-drug conjugates; 2015-08-20.
Ref 11	A Phase I Study of ADCT-402 (Loncastuximab Tesirine), a Novel Pyrrolobenzodiazepine-Based Antibody-Drug Conjugate, in Relapsed/Refractory B-Cell Non-Hodgkin Lymphoma. Clin Cancer Res. 2019 Dec 1;25(23):6986-6994.
Ref 12	Development of novel anti-CD19 antibody-drug conjugates for B-cell lymphoma treatment. Int Immunopharmacol. 2018 Sep;62:299-308. doi: 10.1016/j.intimp.2018.06.034. Epub 2018 Jul 23.
Ref 13	IKS03, a Next Generation CD19-Targeted Antibody Drug Conjugate, Shows Potent Activity in Preclinical Models of Aggressive B-Cell Lymphomas. Blood (2022) 140 (Supplement 1): 31343135.
Ref 14	LegoChem Biosciences and Iksuda enter Licensing Agreement for Antibody Drug Conjugate program; 27 Jan 2021.
Ref 15	The novel CD19-targeting antibody-drug conjugate huB4-DGN462 shows improved anti-tumor activity compared to SAR3419 in CD19-positive lymphoma and leukemia models. Haematologica. 2019 Aug;104(8):1633-1639. doi: 10.3324/haematol.2018.211011. Epub 2019 Feb 7.
Ref 16	CD19 - a potential target for Amanitin-based ADCs. Cancer Res (2017) 77 (13_Supplement): 62.
Ref 17	Lightchain biosciences biotechnology company product pipeline
Ref 18	Introduction to basic information on anti-B4 monoclonal antibody-DC1 conjugate (Anti-B4-DC1).
Ref 19	ADC review: basic information about NV102 (Doxorubicin-Anti-CD19).
Ref 20	Progression towards the clinic by 2025 with a strategy for rapid FIH data acquisition.
Ref 21	Preclinical activity of the antibody-drug conjugate denintuzumab mafodotin (SGN-CD19A) against pediatric acute lymphoblastic leukemia xenografts. Pediatr Blood Cancer. 2019 Aug;66(8):e27765. doi: 10.1002/pbc.27765. Epub 2019 Apr 23.
Ref 22	Introduction to basic information on ADC drug TE-1522.
Ref 23	Effect of liposomes containing sodium butyrate conjugated with anti-CD19 monoclonal antibody on in vitro and in vivo growth of malignant lymphoma. Cancer Res. 1990 Jun 1;50(11):3245-8.
Ref 24	Effective purging of autologous hematopoietic stem cells using anti-B-cell monoclonal antibody-coated high-density microparticles prior to high-dose therapy for patients with non-Hodgkin's lymphoma. Biol Blood Marrow Transplant. 2002;8(8):429-34. doi: 10.1053/bbmt.2002.v8.pm12234168.
Ref 25	Introduction to basic information on ADC drug monoclonal antibody B43 Genistein-conjugate.