General Information of This Antigen
Antigen ID
TAR0QHAVI
Antigen Name
Folate receptor alpha (FOLR1)
Gene Name
FOLR1
Gene ID
2348
Synonym
FOLR; Adult folate-binding protein;Folate receptor 1;Folate receptor, adult;KB cells FBP;Ovarian tumor-associated antigen MOv18
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS

    Click to Show/Hide
Family
Ephrin family
Function
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.

    Click to Show/Hide
Uniprot Entry
FOLR1_HUMAN
HGNC ID
HGNC:3791
KEGG ID
hsa:2348
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
ADC Info ADC Name Payload Target Linker Ref
AMT-151
Duostatin 5
Microtubule (MT)
Undisclosed
[1]
Anti-FOLR1 huFR1-48
ADC Info ADC Name Payload Target Linker Ref
HuFR1-48-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[2]
Anti-FOLR1 huFR1-49
ADC Info ADC Name Payload Target Linker Ref
HuFR1-49-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[2]
Anti-FOLR1 huFR1-57
ADC Info ADC Name Payload Target Linker Ref
HuFR1-57-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[2]
Anti-FOLR1 huFR1-65
ADC Info ADC Name Payload Target Linker Ref
HuFR1-65-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[2]
Anti-FOLR1 mAb
ADC Info ADC Name Payload Target Linker Ref
Anti-FOLR1-Ala-Ala-IGN
Indolinobenzodiazepine dimer
Human Deoxyribonucleic acid (hDNA)
Ala-Ala dipeptide
[3]
Anti-FOLR1-Val-Gln-IGN
Indolinobenzodiazepine dimer
Human Deoxyribonucleic acid (hDNA)
Val-Gln dipeptide linker
[3]
FOLR1-ADC 13a
PBD dimer 13a
Human Deoxyribonucleic acid (hDNA)
Adipic acid-Val-Ala-PABC
[4]
FOLR1-ADC 13b
PBD dimer 13b
Human Deoxyribonucleic acid (hDNA)
Adipic acid-Val-Ala-PABC
[4]
FOLR1-ADC 13c
PBD dimer 13c
Human Deoxyribonucleic acid (hDNA)
Adipic acid-Val-Ala-PABC
[4]
FOLR1-ADC 15
PBD dimer 13c
Human Deoxyribonucleic acid (hDNA)
Adipic acid-Val-CIt-PABC
[4]
ADC Info ADC Name Payload Target Linker Ref
F131-LD038
F131-LD038 payload
Undisclosed
F131-LD038 linker
[5]
F131-LD100
F131-LD100 payload
Undisclosed
F131-LD100 linker
[5]
F131-LD101
F131-LD101 payload
Undisclosed
F131-LD101 linker
[5]
F131-LD110
F131-LD110 payload
Undisclosed
F131-LD110 linker
[5]
F131-LD111
F131-LD111 payload
Undisclosed
F131-LD111 linker
[5]
Farletuzumab
ADC Info ADC Name Payload Target Linker Ref
Farletuzumab ecteribulin
Eribulin
Microtubule (MT)
Mal-PEG2Val-Cit-PAB-OH
[6]
Farletuzumab-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
Farletuzumab-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
Farletuzumab-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
Farletuzumab-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
Farletuzumab-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
Farletuzumab-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
Farletuzumab-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
Farletuzumab-sulfo SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[8]
Farletuzumab-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
FOLR1-Mal-Caproyl-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[8]
FOLR1-Mal-Caproyl-Val-Cit-PABC-MMAE
Monomethyl auristatin E
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[8]
FOLR1-Mal-Caproyl-Val-Cit-PABC-MMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[8]
FOLR1-Mal-PEG2-Ala-Ala-Asn-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2-Ala-Ala-Asn-PABC
[8]
FOLR1-Mal-PEG2-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2
[8]
FOLR1-Mal-PEG2-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2-Val-Cit-PABC
[8]
FOLR1-Mal-PEG4-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4
[8]
FOLR1-Mal-PEG4-tria-PEG3-Dis-dim-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4-triazole-PEG3-Disulfidyl-dimethyl-PABC
[8]
FOLR1-Mal-PEG4-tria-PEG3-Sulfo-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4-triazole-PEG3-Sulfonamide
[8]
FOLR1-Mal-PEG8-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG8-Val-Cit-PABC
[8]
FOLR1-Mal-PEG-Val-Cit-PABC-Cryptophycin
Cryptophycin
Microtubule (MT)
Mal-PEG-Val-Cit-PABC
[8]
FOLR1-Suc/SPAAC-PEG2-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG2
[8]
FOLR1-Suc/SPAAC-PEG3-Dis-dim-PABC-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG3-Disylfidyl-dimethyl-PABC
[8]
FOLR1-Suc/SPAAC-PEG3-Sulfonamide-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG3-Sulfonamide
[8]
FOLR1-Suc/SPAAC-PEG4-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG4
[8]
FOLR1-Suc/SPAAC-PEG4-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG4-Val-Cit-PABC
[8]
Fc-silent FR specific humanized IgG1 antibody
ADC Info ADC Name Payload Target Linker Ref
LY-4170156
Exatecan
DNA topoisomerase 1 (TOP1)
Mal-Polysarcosine10-Val-Ala-PABC
[9]
ADC Info ADC Name Payload Target Linker Ref
FR1-21-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
FR1-21-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
FR1-21-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
FR1-21-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
FR1-21-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
FR1-21-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
FR1-21-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
FR1-21-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
FR1-48-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
FR1-48-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
FR1-48-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
FR1-48-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
FR1-48-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
FR1-48-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
FR1-48-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
FR1-48-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
FR1-49-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
FR1-49-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
FR1-49-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
FR1-49-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
FR1-49-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
FR1-49-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
FR1-49-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
FR1-49-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
FR1-57-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
FR1-57-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
FR1-57-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
FR1-57-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
FR1-57-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
FR1-57-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
FR1-57-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
FR1-57-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
FR1-65-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
FR1-65-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
FR1-65-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
FR1-65-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
FR1-65-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
FR1-65-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
FR1-65-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
FR1-65-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
huFR1-21-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huFR1-21-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
huFR1-21-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
huFR1-21-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
huFR1-21-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
huFR1-21-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
huFR1-21-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
huFR1-21-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
huFR1-23-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huFR1-23-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
huFR1-23-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
huFR1-23-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
huFR1-23-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
huFR1-23-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
huFR1-23-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
huFR1-23-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
Humanized Anti-FOLR1 IgG1 mAb
ADC Info ADC Name Payload Target Linker Ref
ZW191
ZD06519
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly-AM
[10]
ADC Info ADC Name Payload Target Linker Ref
huMov19-3-sulfo-Mal-DM4 (DAR 3.7)
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huMov19-3-sulfo-Mal-DM4 (DAR 8.23)
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huMov19-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
huMov19-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
huMov19-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
huMov19-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
huMov19-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
huMov19-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
huMov19-sulfo-SPDB-DM4 (DAR3.8)
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
huMov19-sulfo-SPDB-DM4 (DAR6.8)
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
huMOV19v1.0
ADC Info ADC Name Payload Target Linker Ref
huMOV19v1.0-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huMOV19v1.0-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
huMOV19v1.0-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
huMOV19v1.0-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
huMOV19v1.0-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
huMOV19v1.0-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
huMOV19v1.0-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
huMOV19v1.0-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
huMOV19v1.6
ADC Info ADC Name Payload Target Linker Ref
huMOV19v1.6-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
huMOV19v1.6-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
huMOV19v1.6-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
huMOV19v1.6-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
huMOV19v1.6-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
huMOV19v1.6-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
huMOV19v1.6-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
huMOV19v1.6-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
IKS-01
FGX2-62
Human Deoxyribonucleic acid (hDNA)
Undisclosed
[11]
Luveltamab
ADC Info ADC Name Payload Target Linker Ref
Luveltamab tazevibulin
SC209
Microtubule (MT)
Val-Cit-PABA
[12]
Mirvetuximab
ADC Info ADC Name Payload Target Linker Ref
Mirvetuximab soravtansine
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[13]
M9346A Sulfo-SPDB DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[2]
M9346A-CX-DM1
Mertansine DM1
Microtubule (MT)
triglycyl peptide linker CX
[14]
M9346A-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
M9346A-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
M9346A-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
M9346A-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
Mirvetuximab-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[2]
Mirvetuximab-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[15]
Mirvetuximab-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[2]
Mirvetuximab (engineered cysteine HC-C118)
ADC Info ADC Name Payload Target Linker Ref
M9346A-4c-Cxxx-Mal-CX-DM1
Mertansine DM1
Microtubule (MT)
Cxxx-Mal-CX
[14]
Mirvetuximab (engineered cysteine HC-C239)
ADC Info ADC Name Payload Target Linker Ref
M9346A-4d-Cxxx-Mal-CX-DM1
Mertansine DM1
Microtubule (MT)
Cxxx-Mal-CX
[14]
Mirvetuximab (engineered cysteine LC-C205)
ADC Info ADC Name Payload Target Linker Ref
M9346A-4a-Cxxx-Mal-CX-DM1
Mertansine DM1
Microtubule (MT)
Cxxx-Mal-CX
[14]
Mirvetuximab (engineered cysteine LC-C400)
ADC Info ADC Name Payload Target Linker Ref
M9346A-4b-Cxxx-Mal-CX-DM1
Mertansine DM1
Microtubule (MT)
Cxxx-Mal-CX
[14]
ADC Info ADC Name Payload Target Linker Ref
Mov19-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
Mov19-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
Mov19-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
Mov19-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
Mov19-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
Mov19-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
Mov19-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
Mov19-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
mu-FR1-13
ADC Info ADC Name Payload Target Linker Ref
muFR1-13-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
muFR1-13-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
muFR1-13-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
muFR1-13-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
muFR1-13-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
muFR1-13-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
muFR1-13-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
muFR1-13-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
mu-FR1-21
ADC Info ADC Name Payload Target Linker Ref
muFR1-21-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
muFR1-21-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
muFR1-21-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
muFR1-21-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
muFR1-21-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
muFR1-21-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
muFR1-21-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
muFR1-21-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
mu-FR1-22
ADC Info ADC Name Payload Target Linker Ref
muFR1-22-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
muFR1-22-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
muFR1-22-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
muFR1-22-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
muFR1-22-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
muFR1-22-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
muFR1-22-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
muFR1-22-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
mu-FR1-23
ADC Info ADC Name Payload Target Linker Ref
muFR1-23-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
muFR1-23-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
muFR1-23-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
muFR1-23-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
muFR1-23-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
muFR1-23-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
muFR1-23-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
muFR1-23-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
ADC Info ADC Name Payload Target Linker Ref
muFR1-9-3-sulfo-Mal-DM4
Mertansine DM4
Microtubule (MT)
3-sulfo-Mal
[7]
muFR1-9-PEG4-Mal-DM1
Mertansine DM1
Microtubule (MT)
PEG4-Mal
[7]
muFR1-9-PEG4-Mal-DM4
Mertansine DM4
Microtubule (MT)
PEG4-Mal
[7]
muFR1-9-SIA-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl iodoacetate (SIA)
[7]
muFR1-9-SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[7]
muFR1-9-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[7]
muFR1-9-SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[7]
muFR1-9-sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[7]
Opugotamig
ADC Info ADC Name Payload Target Linker Ref
IMGN151
DM21-C
Microtubule (MT)
Stable cleavable peptide linker
[16]
Rinatabart
ADC Info ADC Name Payload Target Linker Ref
PRO1184
Exatecan
DNA topoisomerase 1 (TOP1)
Cys-11 ADC linker
[17]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
AZD5335
AZ14170132
DNA topoisomerase 1 (TOP1)
Mal-PEG8-Val-Ala
[18]
BAT8006
Exatecan
DNA topoisomerase 1 (TOP1)
Cleavable linker
[19]
ALT-Q5
Undisclosed
Undisclosed
Undisclosed
[20]
Anti-FolRa Iadc
Undisclosed
Undisclosed
Undisclosed
[21]
DNA-alkylating anti-FRalpha antibody-drug conjugate
Undisclosed
Undisclosed
Undisclosed
[22]
FOLR1 maytansinoid based antibody-drug conjugate
Undisclosed
Undisclosed
Undisclosed
[23]
HuIgG1-SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[2]
IKS-012
Undisclosed
Undisclosed
Undisclosed
[24]
M-DGN549
Undisclosed
Undisclosed
Undisclosed
[25]
BB-17
Undisclosed
Undisclosed
Undisclosed
[26]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.416631034; Fold-change: -0.101542206; Z-score: -0.269317074
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.767866434; Fold-change: 0.272303811; Z-score: 0.229612518
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.49E-05; Fold-change: 0.472663157; Z-score: 2.337980161
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.42E-06; Fold-change: -1.86570532; Z-score: -3.352427456
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000173461; Fold-change: -0.117057172; Z-score: -0.16702187
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.027958502; Fold-change: 0.036497549; Z-score: 0.138822954
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.38E-05; Fold-change: 0.207536395; Z-score: 0.866015541
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.305280741; Fold-change: 0.024091433; Z-score: 0.035357892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.495457292; Fold-change: -0.116804255; Z-score: -0.354198329
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.525830436; Fold-change: 0.063779836; Z-score: 0.13156394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.102778877; Fold-change: -1.386387424; Z-score: -2.358597925
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000893243; Fold-change: -1.014839276; Z-score: -1.338138593
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004290765; Fold-change: 0.172007864; Z-score: 0.359654598
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.65E-14; Fold-change: 0.533479351; Z-score: 0.766436414
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.296394245; Fold-change: -0.355054646; Z-score: -0.31941577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000271454; Fold-change: -0.787210139; Z-score: -0.907752876
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030955384; Fold-change: 0.291392264; Z-score: 0.326944581
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.89E-13; Fold-change: 0.507544491; Z-score: 0.60068777
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.983855722; Fold-change: 0.16662252; Z-score: 0.524691751
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.73E-75; Fold-change: -1.182517793; Z-score: -2.303058889
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.90E-22; Fold-change: -0.99478227; Z-score: -1.383907538
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015385097; Fold-change: -1.307425538; Z-score: -1.036371431
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000343273; Fold-change: 0.098551888; Z-score: 0.184353202
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.239420147; Fold-change: 0.937227152; Z-score: 1.160340111
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.60E-22; Fold-change: -0.707234874; Z-score: -0.695709406
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.19E-07; Fold-change: -1.649081853; Z-score: -1.211044377
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000299394; Fold-change: 1.814366231; Z-score: 2.811538221
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.35E-05; Fold-change: 2.431487159; Z-score: 2.045455627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.742918333; Fold-change: -0.109102262; Z-score: -0.123438684
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.344641356; Fold-change: 0.112563422; Z-score: 0.131928097
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001262576; Fold-change: 2.600283911; Z-score: 3.485606176
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.60E-05; Fold-change: -1.559732592; Z-score: -1.519462285
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.216097922; Fold-change: 0.03173553; Z-score: 0.064142983
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.084868647; Fold-change: -0.193287331; Z-score: -0.584784076
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.51E-26; Fold-change: -1.063778915; Z-score: -1.588004832
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.43E-06; Fold-change: -0.51014243; Z-score: -0.779773379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.000769907; Fold-change: -0.550675221; Z-score: -1.405371256
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.70E-12; Fold-change: -0.857618095; Z-score: -1.15030746
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014832123; Fold-change: 1.211747472; Z-score: 2.625628238
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.721570184; Fold-change: 0.21602485; Z-score: 0.369039119
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.658326265; Fold-change: -0.087290173; Z-score: -0.102271942
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.187527526; Fold-change: 0.126015948; Z-score: 0.135338393
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.09E-09; Fold-change: -1.410517099; Z-score: -3.708325101
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.378372413; Fold-change: -0.214571388; Z-score: -0.550365417
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.201222997; Fold-change: -0.088265422; Z-score: -0.519380998
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.066021968; Fold-change: -0.17920137; Z-score: -1.042340968
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.78023544; Fold-change: 0.070719679; Z-score: 0.50472622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.751629437; Fold-change: -0.166588299; Z-score: -0.517310845
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004917737; Fold-change: 0.448629411; Z-score: 0.921816579
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.4160284; Fold-change: -0.197214597; Z-score: -0.516060675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.550720519; Fold-change: 0.030323615; Z-score: 0.120581484
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040823202; Fold-change: 0.856223889; Z-score: 2.663422098
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.151379667; Fold-change: 0.03758707; Z-score: 0.577573991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.787914373; Fold-change: -0.147217066; Z-score: -0.315434735
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002333186; Fold-change: 0.137687843; Z-score: 0.27639074
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.362501311; Fold-change: -0.077639239; Z-score: -0.271478241
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.326599128; Fold-change: 0.260244997; Z-score: 1.339664739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.07460613; Fold-change: 0.422351205; Z-score: 0.470147269
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.884310147; Fold-change: -0.122847101; Z-score: -0.106279729
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.833674319; Fold-change: -0.184099376; Z-score: -0.13645486
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.665378759; Fold-change: -0.16505186; Z-score: -0.543362662
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.052287607; Fold-change: 0.171997336; Z-score: 0.707513602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.233279289; Fold-change: -0.111946987; Z-score: -0.321134132
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.087943498; Fold-change: -0.765417522; Z-score: -3.735875809
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.169654793; Fold-change: -0.281988256; Z-score: -0.665188654
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.892120354; Fold-change: 0.104463902; Z-score: 0.388407129
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.045540616; Fold-change: -0.143560375; Z-score: -0.336108711
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.843488124; Fold-change: -0.142692181; Z-score: -0.236821249
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.99E-09; Fold-change: -1.666319838; Z-score: -1.04924428
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310279718; Fold-change: 0.103640315; Z-score: 0.28017505
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.304366652; Fold-change: 0.045258902; Z-score: 0.209503739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.207973129; Fold-change: -0.127312898; Z-score: -0.361304287
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.844658622; Fold-change: 0.237571576; Z-score: 0.435801822
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004918225; Fold-change: 0.488906104; Z-score: 1.426433965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.865796867; Fold-change: -0.011721496; Z-score: -0.040754733
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01611077; Fold-change: -0.201998377; Z-score: -0.525701048
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.139969827; Fold-change: 0.089550769; Z-score: 0.37413836
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.89E-28; Fold-change: -0.820275784; Z-score: -1.201995272
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.23E-23; Fold-change: 1.850657949; Z-score: 2.989590094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310695009; Fold-change: 0.259330814; Z-score: 0.818657096
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.070384671; Fold-change: 0.127149557; Z-score: 0.198280125
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.822705258; Fold-change: 0.232209401; Z-score: 0.433330353
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043079546; Fold-change: 0.588307108; Z-score: 2.167077156
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015978922; Fold-change: -0.135342831; Z-score: -1.016565856
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000233563; Fold-change: 0.192987236; Z-score: 0.530311981
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.27E-05; Fold-change: 1.064442985; Z-score: 3.65053917
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.356148727; Fold-change: -0.064683813; Z-score: -0.26100526
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.642233014; Fold-change: -0.007482308; Z-score: -0.019673148
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.861657068; Fold-change: -0.188566131; Z-score: -0.139075525
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.286427884; Fold-change: 0.143671733; Z-score: 0.298437742
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.262137539; Fold-change: 0.481804096; Z-score: 0.975828316
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.083199454; Fold-change: 0.04554798; Z-score: 0.073149416
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001900739; Fold-change: -0.583079932; Z-score: -1.433892612
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.345888225; Fold-change: -0.067140406; Z-score: -0.252525205
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025228469; Fold-change: -0.356287563; Z-score: -0.265063477
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.75E-11; Fold-change: 0.548280627; Z-score: 1.055560484
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002146834; Fold-change: -1.305277454; Z-score: -3.013407758
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014041586; Fold-change: 0.053035702; Z-score: 0.234525508
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.523344837; Fold-change: 0.029544671; Z-score: 0.086394047
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.11E-28; Fold-change: -0.876615156; Z-score: -0.903783616
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.33E-05; Fold-change: 1.10373055; Z-score: 1.012787222
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000184952; Fold-change: -1.40970948; Z-score: -1.745532264
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.02E-23; Fold-change: -0.853737626; Z-score: -1.567779055
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.852609568; Fold-change: 0.077969295; Z-score: 0.085373594
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.268210691; Fold-change: 0.193076533; Z-score: 0.481109405
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.969271797; Fold-change: 0.166939779; Z-score: 0.432049021
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.38605703; Fold-change: 0.130663716; Z-score: 0.446706961
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.531915624; Fold-change: -0.23395813; Z-score: -0.567186118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.221833743; Fold-change: -0.030398444; Z-score: -0.126245384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.07E-05; Fold-change: -0.342916678; Z-score: -2.466796539
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058194208; Fold-change: -1.360617761; Z-score: -2.452000086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.602108639; Fold-change: 0.151280978; Z-score: 0.514253633
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.956234834; Fold-change: 0.091115366; Z-score: 0.238706453
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.197108265; Fold-change: 0.167605091; Z-score: 0.497749642
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.287356411; Fold-change: 0.228443176; Z-score: 0.163179294
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.361645108; Fold-change: 0.077112384; Z-score: 0.28123064
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.311341731; Fold-change: -0.06092053; Z-score: -0.240246113
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039013507; Fold-change: 0.34608692; Z-score: 1.38337304
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.295302989; Fold-change: 0.267435345; Z-score: 0.900773198
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00571126; Fold-change: -0.187491667; Z-score: -0.688242644
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.184662059; Fold-change: 0.054466154; Z-score: 0.180458767
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.684848796; Fold-change: 0.218941125; Z-score: 0.663406219
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.626434938; Fold-change: -0.189058822; Z-score: -0.265771322
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189879079; Fold-change: 0.145402711; Z-score: 0.324596586
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.092069246; Fold-change: 0.25190915; Z-score: 0.483741805
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.227609236; Fold-change: -0.190459895; Z-score: -1.007670525
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.19155416; Fold-change: 0.114662897; Z-score: 0.243129356
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252284751; Fold-change: 0.103990907; Z-score: 0.300130605
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043910009; Fold-change: 0.108326642; Z-score: 0.304382856
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 AMT-151 in Patients With Selected Advanced Solid Tumours; NCT05498597.
Ref 2 IMGN853, a Folate Receptor- (FR)-Targeting Antibody-Drug Conjugate, Exhibits Potent Targeted Antitumor Activity against FR-Expressing Tumors. Mol Cancer Ther. 2015 Jul;14(7):1605-13.
Ref 3 Optimizing Lysosomal Activation of Antibody-Drug Conjugates (ADCs) by Incorporation of Novel Cleavable Dipeptide Linkers. Mol Pharm. 2019 Dec 2;16(12):4817-4825. doi: 10.1021/acs.molpharmaceut.9b00696. Epub 2019 Oct 29.
Ref 4 Synthesis of Highly Potent N-10 Amino-Linked DNA-Alkylating Indolinobenzodiazepine Antibody-Drug Conjugates (ADCs). ACS Med Chem Lett. 2019 Jul 22;10(8):1211-1215. doi: 10.1021/acsmedchemlett.9b00254. eCollection 2019 Aug 8.
Ref 5 Linkers, drug linkers and conjugates thereof and methods of using the same; 2023-02-16.
Ref 6 First-in-Human Phase 1 Study of MORAb-202, an Antibody-Drug Conjugate Comprising Farletuzumab Linked to Eribulin Mesylate, in Patients with Folate Receptor--Positive Advanced Solid Tumors. Clin Cancer Res. 2021 Jul 15;27(14):3905-3915. doi: 10.1158/1078-0432.CCR-20-4740.
Ref 7 Folate receptor 1 antibodies and immunoconjugates and uses thereof; 2011-09-01.
Ref 8 MORAb-202, an Antibody-Drug Conjugate Utilizing Humanized Anti-human FR Farletuzumab and the Microtubule-targeting Agent Eribulin, has Potent Antitumor Activity. Mol Cancer Ther. 2018 Dec;17(12):2665-2675. doi: 10.1158/1535-7163.MCT-17-1215. Epub 2018 Sep 27.
Ref 9 Mablink bioscience company product pipeline
Ref 10 ZW191, a novel FRa-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 2641.
Ref 11 IKS01, a next generation antibody drug conjugate, shows target-dependent efficacy in a platinum-resistant tumor model with low levels of folate receptor alpha expression. Mol Cancer Ther (2019) 18 (12_Supplement): C023.
Ref 12 REFRaME-O1: A Study to Investigate the Efficacy and Safety of Luveltamab Tazevibulin in Women With Ovarian Cancer (Including Fallopian Tube or Primary Peritoneal Cancers) Expressing FOLR1
Ref 13 Phase III, randomized trial of mirvetuximab soravtansine versus chemotherapy in patients with platinum-resistant ovarian cancer: primaryanalysis of FORWARD I. Ann Oncol. 2021 Jun;32(6):757-765.
Ref 14 A Case Study Comparing Heterogeneous Lysine- and Site-Specific Cysteine-Conjugated Maytansinoid Antibody-Drug Conjugates (ADCs) Illustrates the Benefits of Lysine Conjugation. Mol Pharm. 2019 Sep 3;16(9):3926-3937. doi: 10.1021/acs.molpharmaceut.9b00529. Epub 2019 Jul 31.
Ref 15 Introduction to basic information on ADC drug anti-FR (clone M9346A)-SPDB-DM4.
Ref 16 IMGN151-A next generation folate receptor alpha targeting antibody drug conjugate active against tumors with low, medium and high receptor expression. Cancer Res (2020) 80 (16_Supplement): 2890.
Ref 17 PRO1184, a novel folate receptor alpha-directed antibody-drug conjugate, demonstrates robust anti-tumor activity in mouse carcinoma models. Cancer Res (2022) 82 (12_Supplement): 1085.
Ref 18 First disclosure of AZD5335, a TOP1i-ADC targeting low and high FR-expressing ovarian cancer with superior preclinical activity vs FR-MTI ADC. Cancer Res (2023) 83 (8_Supplement): LB025.
Ref 19 BAT8006, a novel FR ADC with strong bystander effect, for the treatment of advanced solid tumor. Cancer Res (2023) 83 (5_Supplement): P4-01-12.
Ref 20 Alteogen biotechnology company product pipeline
Ref 21 Next-generation immunostimulatory antibody-drug conjugate (iADC) combines direct tumor killing and innate immune stimulation to provide protective anti-tumor immunity;
Ref 22 A new class of DNA alkylating indolino-benzodiazepine agents (BIAs) linked with a DNA binding moiety for use with antibody-drug conjugates (ADCs). Cancer Res (2018) 78 (13_Supplement): 747.
Ref 23 Introduction to basic information on maytansinoid based antibody-drug conjugate.
Ref 24 Iksuda therapeutics product pipeline
Ref 25 Preclinical evaluation of M-DGN549, a folate receptor alpha-targeting antibodydrug conjugate (ADC) with a DNA-alkylating payload. December 2016 European journal of cancer 69(1):S145.
Ref 26 Introduction to basic information on ADC drug BB-17.