Antibody Information

General Information of This Antibody
Antibody ID
ANI0QYT009
Antibody Name
Opugotamig
Antigen Name
Folate receptor alpha (FOLR1)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDGDTFY
NQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQGTTVTVSS
    Click to Show/Hide
Light Chain Sequence
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA
GVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
IMGN151 [Phase 1]
 ADC Info 
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
High FOLR1 expression (FOLR1+++; IHC H-score=300)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model KB CDX model
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Moderate FOLR1 expression (FOLR1++; IHC H-score=140)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model IGROV-1 CDX model
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Moderate FOLR1 expression (FOLR1++; IHC H-score=100)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model Ishikawa CDX model
In Vitro Model Endometrial adenocarcinoma Ishikawa cells CVCL_2529
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low FOLR1 expression (FOLR1+; IHC H-score=30)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model OV-90 CDX model
In Vitro Model Ovarian adenocarcinoma OV-90 cells CVCL_3768
References
Ref 1 IMGN151-A next generation folate receptor alpha targeting antibody drug conjugate active against tumors with low, medium and high receptor expression. Cancer Res (2020) 80 (16_Supplement): 2890.