General Information of This Antibody (ID: ANI0QYT009)
Antibody Name
Opugotamig
Organization
ImmunoGen, Inc.
Synonyms
Opugotamig
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Folate receptor alpha (FOLR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDGDTFY
NQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQGTTVTVSS
    Click to Show/Hide
Light Chain Sequence
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA
GVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Opugotamig olatansine [Phase 2]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Inclusion Criteria: ECOG PS 0-1, histologically confirmed recurrent/metastatic gynecologic cancers (specific requirements per cohort including prior therapy limits). Measureable disease by RECIST v1.1 (optimization/expansion phases), willingness to provide tumor tissue, recovery from prior toxicities (≤Grade 1), adequate organ function. Exclusion Criteria: Certain histologic subtypes, primary platinum-refractory disease (cohort B), >Grade 1 peripheral neuropathy, active ocular disorders, uncontrolled cardiac disease, CNS metastases, prior FRalpha-targeting agents (except cohort C), other malignancies within 3 years, pregnancy/lactation.

   Click to Show/Hide
Administration Dosage
IMGN151 is administered via intravenous (IV) infusion on Day 1 of Cycle 1 every 3-week cycle (Q3W).
Related Clinical Trial
NCT Number NCT05527184  Clinical Status PHASE1
Clinical Description
A Phase 1, First-in-Human, Open-Label, Dose-Escalation and Expansion Study of IMGN151 (Anti-FRalpha Antibody-drug Conjugate) in Adult Patients With Recurrent Gynaecological Cancers
Primary Endpoint
The study evaluates safety and tolerability of IMGN151 monotherapy through adverse events (AEs), serious adverse events (SAEs), and dose-limiting toxicities (DLTs) within the first cycle (21 days). The recommended dose is determined over approximately 2 years.
Other Endpoint
Pharmacokinetics (PK) of IMGN151 are assessed via maximum plasma concentration (Cmax), time to Cmax (Tmax), and area under the curve (AUC0-inf). Immunogenicity is measured through anti-drug antibodies (ADAs). Efficacy endpoints include objective response rate (ORR) and duration of response (DOR) per RECIST v1.1, evaluated over approximately 3 years.

   Click to Show/Hide
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
Low FOLR1 expression (FOLR1+; IHC H-score=30)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model OV-90 CDX model
In Vitro Model Ovarian adenocarcinoma OV-90 cells CVCL_3768
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
Moderate FOLR1 expression (FOLR1++; IHC H-score=100)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model Ishikawa CDX model
In Vitro Model Endometrial adenocarcinoma Ishikawa cells CVCL_2529
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
Moderate FOLR1 expression (FOLR1++; IHC H-score=140)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model IGROV-1 CDX model
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 4 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
High FOLR1 expression (FOLR1+++; IHC H-score=300)
Method Description
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
In Vivo Model KB CDX model
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
References
Ref 1 First in Human Study of IMGN151 in Recurrent Gynaecological Cancers
Ref 2 IMGN151-A next generation folate receptor alpha targeting antibody drug conjugate active against tumors with low, medium and high receptor expression. Cancer Res (2020) 80 (16_Supplement): 2890.