Antibody Information
General Information of This Antibody (ID: ANI0QYT009)
| Antibody Name | Opugotamig |
|||||
|---|---|---|---|---|---|---|
| Organization | ImmunoGen, Inc. |
|||||
| Synonyms |
Opugotamig
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Folate receptor alpha (FOLR1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDGDTFY
NQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQGTTVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA
GVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Opugotamig olatansine [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Inclusion Criteria: ECOG PS 0-1, histologically confirmed recurrent/metastatic gynecologic cancers (specific requirements per cohort including prior therapy limits). Measureable disease by RECIST v1.1 (optimization/expansion phases), willingness to provide tumor tissue, recovery from prior toxicities (≤Grade 1), adequate organ function. Exclusion Criteria: Certain histologic subtypes, primary platinum-refractory disease (cohort B), >Grade 1 peripheral neuropathy, active ocular disorders, uncontrolled cardiac disease, CNS metastases, prior FRalpha-targeting agents (except cohort C), other malignancies within 3 years, pregnancy/lactation.
Click to Show/Hide
|
||||
| Administration Dosage |
IMGN151 is administered via intravenous (IV) infusion on Day 1 of Cycle 1 every 3-week cycle (Q3W).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05527184 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, First-in-Human, Open-Label, Dose-Escalation and Expansion Study of IMGN151 (Anti-FRalpha Antibody-drug Conjugate) in Adult Patients With Recurrent Gynaecological Cancers
|
||||
| Primary Endpoint |
The study evaluates safety and tolerability of IMGN151 monotherapy through adverse events (AEs), serious adverse events (SAEs), and dose-limiting toxicities (DLTs) within the first cycle (21 days). The recommended dose is determined over approximately 2 years.
|
||||
| Other Endpoint |
Pharmacokinetics (PK) of IMGN151 are assessed via maximum plasma concentration (Cmax), time to Cmax (Tmax), and area under the curve (AUC0-inf). Immunogenicity is measured through anti-drug antibodies (ADAs). Efficacy endpoints include objective response rate (ORR) and duration of response (DOR) per RECIST v1.1, evaluated over approximately 3 years.
Click to Show/Hide
|
||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100%
|
Low FOLR1 expression (FOLR1+; IHC H-score=30) | ||
| Method Description |
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
|
||||
| In Vivo Model | OV-90 CDX model | ||||
| In Vitro Model | Ovarian adenocarcinoma | OV-90 cells | CVCL_3768 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100%
|
Moderate FOLR1 expression (FOLR1++; IHC H-score=100) | ||
| Method Description |
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
|
||||
| In Vivo Model | Ishikawa CDX model | ||||
| In Vitro Model | Endometrial adenocarcinoma | Ishikawa cells | CVCL_2529 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100%
|
Moderate FOLR1 expression (FOLR1++; IHC H-score=140) | ||
| Method Description |
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
|
||||
| In Vivo Model | IGROV-1 CDX model | ||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100%
|
High FOLR1 expression (FOLR1+++; IHC H-score=300) | ||
| Method Description |
IMGN151 activity was characterized against cell lines and xenograft models with a wide range of FR expression and compared to IMGN853.
|
||||
| In Vivo Model | KB CDX model | ||||
| In Vitro Model | Human papillomavirus-related endocervical adenocarcinoma | KB cells | CVCL_0372 | ||
References
