General Information of This Antibody (ID: ANI0RYL006)
Antibody Name
Rinatabart
Organization
ProfoundBio (Suzhou) Co., Ltd.
Synonyms
Rinatabart
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Folate receptor alpha (FOLR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYY
ADSVKGRFTISRANSKNTLYLQMNSLRAEDTAVYYCARPRAYYGAYGSSFDYWGQGTQVT
VSS
    Click to Show/Hide
Light Chain Sequence
EIVMTQSPSSVSASVGDRVAITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVDIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Rinatabart sesutecan [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Inclusion: Part A/B-metastatic/unresectable solid tumors (ovarian/NSCLC/breast cancers, mesothelioma) refractory to prior therapy; Part C-BRCA-tested, platinum-resistant ovarian cancer (1-3 prior lines, FRalpha+ must have received mirvetuximab soravtansine); Part D-platinum-sensitive/refractory ovarian cancer (cohort-specific prior therapies); Part F-endometrial cancer (1-3 prior lines, post-PD-[L]1 inhibitor). Exclusions: ILD/pneumonitis, strong CYP3A inhibitors (dose escalation), prior topoisomerase-1 inhibitor ADCs.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT05579366  Clinical Status PHASE1|||PHASE2
Clinical Description
Phase 1/2 Study of Rina-S in Patients With Locally Advanced and/or Metastatic Solid Tumors
Primary Endpoint
In Parts A, B, and D, safety assessments include incidence, severity, and seriousness of treatment-emergent adverse events (TEAEs) and dose-limiting toxicities (DLTs) evaluated through the end of treatment (up to ~1 year). DLTs are specifically analyzed at the end of Cycle 1 (21-day cycles). Parts C and F report objective response rate (ORR) via blinded independent central review (BICR) per RECIST v1.1.

   Click to Show/Hide
Other Endpoint
Efficacy measures include best overall response (BOR), ORR, disease control rate (DCR), progression-free survival (PFS), overall survival (OS), and duration of response (DOR). Pharmacokinetic parameters (Cmax, AUC, Tmax, Ctrough, t1/2) of Rina-S are assessed. Parts C and D evaluate CA-125 response using GCIG criteria, and Parts C and F assess adverse events (CTCAE v5.0).

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Exclusions: prior topoisomerase-1 inhibitor ADCs; primary platinum-refractory disease (progression ≤91 days post-1st-line platinum); active malignancy within 3 years (exceptions: low-risk cancers); active CNS metastases (unless stable ≥4 weeks post-treatment); symptomatic GI obstruction/ascites requiring frequent paracentesis. Other protocol-specific criteria may apply.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06619236  Clinical Status PHASE3
Clinical Description
A Phase 3 Randomized, Open-label Study of Rinatabart Sesutecan (Rina-S) Versus Treatment of Investigator's Choice (IC) in Patients With Platinum Resistant Ovarian Cancer
Primary Endpoint
The primary efficacy endpoints include progression-free survival (PFS), defined as time from randomization to first progression or death per RECIST v1.1, and overall survival (OS), measured from randomization to death from any cause. Secondary endpoints include objective response rate (ORR), duration of response (DOR), CA-125 response per GCIG criteria (≥50% reduction), PFS2 (time to second progression/death), and quality of life assessments via EORTC-QLQ-C30 (GHS/QoL score changes and time to deterioration [TTD]). Safety will be monitored through TEAEs, lab abnormalities, and ECG/QTc changes (Holter monitoring during Cycle 1).

   Click to Show/Hide
Other Endpoint
Inclusion criteria: histologically confirmed high-grade serous/endometrioid ovarian, peritoneal, or fallopian tube cancer (regardless of FRalpha status) with 1-4 prior lines. Must have received platinum chemo, bevacizumab (if standard), and PARP inhibitors (if BRCA-mutated and eligible); prior mirvetuximab soravtansine required if FRalpha+ (unless contraindicated). Platinum-resistant disease defined as progression 91-183 days post-platinum (1st line) or ≤183 days (2nd-4th lines).

   Click to Show/Hide
Experiment 3 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT05579366  Clinical Status Phase 1/2
Clinical Description
Phase 1/2 study of PRO1184 in patients with locally advanced and/or metastatic solid tumors.
References
Ref 1 Rinatabart Sesutecan (Rina-S) for Advanced Solid Tumors (GCT1184-01/ PRO1184-001)
Ref 2 Study to Assess the Efficacy of Rina-S Compared to Treatment of Investigator's Choice in Participants With Platinum Resistant Ovarian Cancer
Ref 3 Phase 1/2 Study of PRO1184 in Patients With Locally Advanced and/or Metastatic Solid Tumors, NCT05579366