Antibody Information

General Information of This Antibody
Antibody ID
ANI0KEFUA
Antibody Name
Luveltamab
Synonyms
SP8166
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Folate receptor alpha (FOLR1)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
MEVQLVESGGGLVQPGGSLRLSCAASGFNIRTQSIHWVRQAPGKGLEWIGDIFPIDGITD
YADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGSWSWPSGMDYYLDYWGQGTL
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLFSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV
DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
MDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Luveltamab tazevibulin [Phase 2]
 ADC Info 
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
15.00%
Negative FOLR1 expression (FOLR1-)
In Vivo Model STRO-002 monotherapy PDX model (PDX:PDX model 5)
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
53.00%
Low FOLR1 expression (FOLR1+)
In Vivo Model PDX model
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
70.00%
Moderate FOLR1 expression (FOLR1++)
In Vivo Model PDX model
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
80.00%
High FOLR1 expression (FOLR1+++)
In Vivo Model PDX model
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
High FOLR1 expression (FOLR1+++)
In Vivo Model PDX model
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
High FOLR1 expression (FOLR1+++)
In Vivo Model PDX model
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 26 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.24 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Lung squamous cell carcinoma NCI-H1703 cells CVCL_1490
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.74 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.84 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Lung non-small cell carcinoma NCI-H2110 cells CVCL_1530
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.40 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Skin squamous cell carcinoma A431 cells CVCL_0037
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.42 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.70 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.80 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Amelanotic melanoma MDA-MB-435 cells CVCL_0417
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.20 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.29 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Amelanotic melanoma MDA-MB-435 cells CVCL_0417
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.42 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Plasma cell myeloma OPM-2 cells CVCL_1625
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
3.18 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
3.59 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
7.90 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Lung adenocarcinoma A-549 cells CVCL_0023
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
9.18 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Colon carcinoma HCT 116 cells CVCL_0291
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
9.20 nM
Low FOLR1 expression (FOLR1+)
In Vitro Model Lung adenocarcinoma NCI-H1651 cells CVCL_1484
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.07 ng/mL
Moderate FOLR1 expression (FOLR1++)
Method Description
STRO-002 in lgrov1 cell.
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 17 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.35 ng/mL
High FOLR1 expression (FOLR1+++)
Method Description
STRO-002 in KB cell.
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 18 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.42 ng/mL
Low FOLR1 expression (FOLR1+)
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-6 cells CVCL_2206
Experiment 19 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.60 ng/mL
Low FOLR1 expression (FOLR1+)
In Vitro Model Endometrial adenocarcinoma Ishikawa cells CVCL_2529
Experiment 20 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.10 ng/mL
Low FOLR1 expression (FOLR1+)
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 21 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.20 ng/mL
Moderate FOLR1 expression (FOLR1++)
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 22 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
2.80 ng/mL
Low FOLR1 expression (FOLR1+)
In Vitro Model High grade ovarian serous adenocarcinoma OVKATE cells CVCL_3110
Experiment 23 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
3.60 ng/mL
Moderate FOLR1 expression (FOLR1++)
Method Description
SC209 in lgrov1 cell.
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 24 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
3.90 ng/mL
High FOLR1 expression (FOLR1+++)
Method Description
SC209 in KB cell.
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 25 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
291.00 ng/mL
Moderate FOLR1 expression (FOLR1++)
Method Description
SC239 in lgrov1 cell.
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 26 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Effective Concentration (EC50)
400.00 ng/mL
High FOLR1 expression (FOLR1+++)
Method Description
SC239 in KB cell.
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
References
Ref 1 Discovery of STRO-002, a Novel Homogeneous ADC Targeting Folate Receptor Alpha, for the Treatment of Ovarian and Endometrial Cancers. Mol Cancer Ther. 2023 Feb 1;22(2):155-167.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.