General Information of This Antibody
Antibody ID
ANI0JERHT
Antibody Name
Mirvetuximab (engineered cysteine LC-C205)
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Chimeric IgG1-kappa
Antigen Name
Folate receptor alpha (FOLR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDGDTFY
NQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQGTTVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASNLEA
GVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGSSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
M9346A-4a-Cxxx-Mal-CX-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 41.22% (Day 23) Positive FOLR1 expression (FOLR1 +++/++)
Method Description
M9346A-4a-Cxxx-Mal-CX-DM1 (200 ug/kg, every seven days x3) induces efficient tumor cell killing in cell line-derived models of KB cells with HER2 expression with high expression.
In Vivo Model KB CDX model
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.58% (Day 23) Positive FOLR1 expression (FOLR1 +++/++)
Method Description
M9346A-4a-Cxxx-Mal-CX-DM1 (100 ug/kg, every seven days x3) induces efficient tumor cell killing in cell line-derived models of KB cells with HER2 expression with high expression.
In Vivo Model KB CDX model
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.15 nM
Positive FOLR1 expression (FOLR1 +++/++)
Method Description
Cytotoxic IC50 Values (as a Function of [ADC] and [DM1]) for Various M9346A-CX-DM1 ADCs against FR-Expressing KB Cells in the absence of 1 M unconjugated M9346A antibody.
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.00 nM
Positive FOLR1 expression (FOLR1 +++/++)
Method Description
Cytotoxic IC50 Values (as a Function of [ADC] and [DM1]) for Various M9346A-CX-DM1 ADCs against FOLR1-Expressing KB Cells in the presence of 1 M unconjugated M9346A antibody.
In Vitro Model Human papillomavirus-related endocervical adenocarcinoma KB cells CVCL_0372
References
Ref 1 A Case Study Comparing Heterogeneous Lysine- and Site-Specific Cysteine-Conjugated Maytansinoid Antibody-Drug Conjugates (ADCs) Illustrates the Benefits of Lysine Conjugation. Mol Pharm. 2019 Sep 3;16(9):3926-3937. doi: 10.1021/acs.molpharmaceut.9b00529. Epub 2019 Jul 31.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.