Target Information
General Information of This Target
| Target ID | PATR0QBNMQ |
|||||
|---|---|---|---|---|---|---|
| Target Name | DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
|||||
| Gene Name | POLR2B; POLR3G |
|||||
| Gene ID | ||||||
| Synonym 1 | DNA-directed RNA polymerase II 140 kDa polypeptide; DNA-directed RNA polymerase II subunit B; RNA polymerase II subunit 2; RNA polymerase II subunit B2 |
|||||
| Synonym 2 | DNA-directed RNA polymerase III subunit G; RNA polymerase III 32 kDa apha subunit; RNA polymerase III 32 kDa subunit |
|||||
| Sequence 1 |
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV Click to Show/Hide
|
|||||
| Sequence 2 |
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY Click to Show/Hide
|
|||||
| Family | the RNA polymerase beta chain family; the eukaryotic RPC7 RNA polymerase subuni |
|||||
| Function 1 |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB2 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template.
Click to Show/Hide
|
|||||
| Function 2 |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs), induce type I interferon and NF- Kappa-B through the RIG-I pathway
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Full List of The ADC Related to This Target
Clinical candidate
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
Trastuzumab-ATAC |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Undisclosed |
[1] | |
HuMAB-5B1-ATAC |
MVT-5873 |
Lewis A (LeA) |
Alpha-amanitin |
Undisclosed |
[2] | |
H14A043-ATAC |
Human Anti-CDCP1 h14A043-ATAC mAb |
CUB domain-containing protein 1 (CDCP1) |
Alpha-amanitin |
Undisclosed |
[3] | |
HuMAB 5B1 targeted amanitin conjugate |
5B1 |
Sialyl Lewis A (sLeA) |
Alpha-amanitin |
Undisclosed |
[4] | |
TAK-ATACs |
Undisclosed |
Undisclosed |
Alpha-amanitin |
Undisclosed |
[5] | |
Antibody targeted amanitin conjugate |
Undisclosed |
Undisclosed |
Alpha-amanitin |
Undisclosed |
[6] | |
HDP-103 |
Undisclosed |
Glutamate carboxypeptidase 2 (FOLH1) |
Alpha-amanitin |
Undisclosed |
[7] | |
Alpha-amanitin antibody-drug conjugate (Agensys) |
Undisclosed |
Undisclosed |
Alpha-amanitin |
Undisclosed |
[8] | |
T-D265C-CN-Pro-amanitin |
Trastuzumab D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
CN-Pro-dideoxy-alpha-amanitin |
Mal-Val-Ala-PAB |
[9] | |
CD19-ATAC |
Undisclosed |
B-lymphocyte antigen CD19 (CD19) |
HDP 30.2115 |
Mal-Val-Ala-PAB |
[10] | |
T-D265C-NH2-Pro-amanitin |
Trastuzumab D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
NH2-Pro-dideoxy-alpha-amanitin |
Mc-Val-Ala-PABC |
[9] | |
T-D265C-OH-Pro-amanitin |
Trastuzumab D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
OH-Pro-dideoxy-alpha-amanitin |
Mc-Val-Ala-PABC |
[9] | |
OHPAS ADC-1 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Ortho-hydroxy-protected aryl sulfate |
[11] | |
Ab85 D265C/H435A ADC A |
Ab85 D265C/H435A |
T-cell surface antigen CD2 (CD2) |
Amaninamide (thioether) |
Mc-Val-Ala-PABC |
[12] | |
CD2 RPA2.10 D265C/H435A ADC A |
CD2 RPA2.10 D265C/H435A |
T-cell surface antigen CD2 (CD2) |
Amaninamide (thioether) |
Mc-Val-Ala-PABC |
[12] | |
CD2 RPA2.10 D265C/H435A ADC C |
CD2 RPA2.10 D265C/H435A |
T-cell surface antigen CD2 (CD2) |
Alpha-amanitin (thioether) |
Maleimido-caproyl |
[12] | |
CD5 5D7 D265C/H435A ADC A |
CD5 5D7 D265C/H435A |
T-cell surface glycoprotein CD5 (CD5) |
Amaninamide (thioether) |
Mc-Val-Ala-PABC |
[12] | |
CD5 5D7 D265C/H435A ADC C |
CD5 5D7 D265C/H435A |
T-cell surface glycoprotein CD5 (CD5) |
Alpha-amanitin (thioether) |
Maleimido-caproyl |
[12] | |
Anti-HER2-D265C-30.2060 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.206 |
Mc-Val-Ala-PABC |
[12] | |
Anti-HER2-D265C-30.2115 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.2115 |
Mc-Val-Ala-PABC |
[12] | |
Anti-HER2-D265C-30.2347 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.2347 |
Mc-Val-Ala-PABC |
[12] | |
Anti-HER2-D265C-30.1699 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.1699 |
Mc-Val-Ala-PABC |
[12] | |
Anti-HER2-D265C-30.2371 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.2371 |
Mc-Val-Ala-PABC |
[12] | |
Anti-HER2-D265C-30.0880 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.088 |
Maleimido-caproyl |
[12] | |
Anti-HER2-D265C-30.2867 |
Anti-HER2-D265C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.2867 |
Maleimido-caproyl |
[12] | |
Anti-PSMA-D265C-30.2060 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.206 |
Mc-Val-Ala-PABC |
[12] | |
Anti-PSMA-D265C-30.2115 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.2115 |
Mc-Val-Ala-PABC |
[12] | |
Anti-PSMA-D265C-30.2347 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.2347 |
Mc-Val-Ala-PABC |
[12] | |
Anti-PSMA-D265C-30.1699 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.1699 |
Mc-Val-Ala-PABC |
[12] | |
Anti-PSMA-D265C-30.2371 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.2371 |
Mc-Val-Ala-PABC |
[12] | |
Anti-PSMA-D265C-30.0880 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.088 |
Maleimido-caproyl |
[12] | |
Anti-PSMA-D265C-30.2867 |
Anti-PSMA-D265C |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.2867 |
Maleimido-caproyl |
[12] | |
T (Anti-HER2)-30.2060 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.206 |
Mc-Val-Ala-PABC |
[12] | |
H3/F11-Var16 (Anti-PSMA)-30.2060 |
Anti-PSMA mAb h3/F11-Var16 |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.206 |
Mc-Val-Ala-PABC |
[12] | |
T (Anti-HER2)-30.2867 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Amanitin 30.2867 |
Maleimido-caproyl |
[12] | |
H3/F11-Var16 (Anti-PSMA)-30.2867 |
Anti-PSMA mAb h3/F11-Var16 |
Glutamate carboxypeptidase 2 (FOLH1) |
Amanitin 30.2867 |
Maleimido-caproyl |
[12] | |
LCB14-alpha-amanitin |
Anti-CD19 mAb DI-B4 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
LCB14-alpha-amanitin linker |
[13] | |
Anti-CD19(LC)-G7VIM-amanitin |
DI-B4-(LC)-GGGGGGG-CVIM |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
Anti-CD19(LC)-G7VIM-amanitin linker |
[13] | |
Blinatumomab-amanitin |
Blinatumomab |
B-lymphocyte antigen CD19 (CD19); T-cell surface glycoprotein CD3 delta chain (CD3D) |
Alpha-amanitin |
Blinatumomab-amanitin linker |
[13] | |
Inebilizumab-amanitin |
Inebilizumab |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
Inebilizumab-amanitin linker |
[13] | |
Tafasitamab-amanitin |
Tafasitamab |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
Tafasitamab-amanitin linker |
[13] | |
Obexelimab-amanitin |
Obexelimab |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
Obexelimab-amanitin linker |
[13] | |
MDX-1342-amanitin |
MDX-1342 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
MDX-1342-amanitin linker |
[13] | |
MDX-1435-amanitin |
MDX-1435 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
MDX-1435-amanitin linker |
[13] | |
CHD37-amanitin |
cHD37 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
cHD37-amanitin linker |
[13] | |
AFM-11-amanitin |
AFM-11 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
AFM-11-amanitin linker |
[13] | |
AFM-12-amanitin |
AFM-12 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
AFM-12-amanitin linker |
[13] | |
GBR401-amanitin |
GBR401 |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
GBR401-amanitin linker |
[13] | |
Denintuzumab-amanitin |
Denintuzumab |
B-lymphocyte antigen CD19 (CD19) |
Alpha-amanitin |
Denintuzumab-amanitin linker |
[13] | |
Cetuximab (LC) G7-CVIM-amanitin |
Cetuximab (LC) G7-CVIM |
Epidermal growth factor receptor (EGFR) |
Alpha-amanitin |
Cetuximab(LC) G7-CVIM-amanitin linker |
[14] | |
Cetuximab (LV) G7-CVIM-amanitin |
Cetuximab (LV) G7-CVIM |
Epidermal growth factor receptor (EGFR) |
Alpha-amanitin |
Cetuximab(LV) G7-CVIM-amanitin linker |
[14] | |
Cetuximab (LC)-amanitin |
Cetuximab (LC) |
Epidermal growth factor receptor (EGFR) |
Alpha-amanitin |
Cetuximab(LC)-amanitin linker |
[14] | |
WO2017089895A1 ADC21 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089895A1_ADC21 linker |
[15] | |
WO2017089895A1 ADC22 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089895A1_ADC22 linker |
[15] | |
WO2017089895A1 ADC56 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089895A1_ADC56 linker |
[15] | |
WO2017089895A1 ADC57 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089895A1_ADC57 linker |
[15] | |
huHEA125-amanitin1 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Beta-amanitin |
huHEA125-Amanitin1 linker |
[16] | |
Omalizumab-amanitin 1 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Beta-amanitin |
Omalizumab-Amanitin1 linker |
[16] | |
Trastuzumab-amanitin 1 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Beta-amanitin |
Trastuzumab-Amanitin1 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 3 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 3 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 3 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 3 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 3 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 3 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 4 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 4 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 4 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 4 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 4 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 4 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 7 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 7 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 7 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 7 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 7 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 7 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 10 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 10 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 10 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 10 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 10 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 10 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 11 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 11 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 11 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 11 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 11 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 11 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 14 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 14 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 14 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 14 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 14 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 14 linker |
[16] | |
Trastuzumab-alpha-amanitin conjugate 15 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
Trastuzumab-alpha-amanitin conjugate 15 linker |
[16] | |
huHEA125-alpha-amanitin conjugate 15 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Alpha-amanitin |
huHEA125-alpha-amanitin conjugate 15 linker |
[16] | |
Omalizumab-alpha-amanitin conjugate 15 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Alpha-amanitin |
Omalizumab-alpha-amanitin conjugate 15 linker |
[16] | |
huHEA125-amanitin3 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Beta-amanitin |
huHEA125-Amanitin3 linker |
[16] | |
Omalizumab-amanitin 3 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Beta-amanitin |
Omalizumab-Amanitin3 linker |
[16] | |
Trastuzumab-amanitin 3 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Beta-amanitin |
Trastuzumab-Amanitin3 linker |
[16] | |
huHEA125-amanitin4 |
huHEA125 |
Epithelial cell adhesion molecule (EPCAM) |
Beta-amanitin |
huHEA125-Amanitin4 linker |
[16] | |
Omalizumab-amanitin 4 |
Omalizumab |
High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) |
Beta-amanitin |
Omalizumab-Amanitin4 linker |
[16] | |
Trastuzumab-amanitin 4 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Beta-amanitin |
Trastuzumab-Amanitin4 linker |
[16] | |
Her-30.0643 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
HDP 30.0643 |
Her-30.0643 linker |
[17] | |
WO2017089890A1 ADC21 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089890A1_ADC21 linker |
[18] | |
WO2017089890A1 ADC22 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089890A1_ADC22 linker |
[18] | |
WO2017089890A1 ADC56 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089890A1_ADC56 linker |
[18] | |
WO2017089890A1 ADC57 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Alpha-amanitin |
WO2017089890A1_ADC57 linker |
[18] |
Investigative
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
hRS7 ATAC 1 |
hRS7 |
Tumor-associated calcium signal transducer 2 (TACSTD2) |
Alpha-amanitin |
Mal-Val-Ala-PAB |
[19] | |
hRS7 ATAC 2 |
hRS7 |
Tumor-associated calcium signal transducer 2 (TACSTD2) |
Alpha-amanitin |
Maleimide-noncleavable-C6-linker |
[19] |
References
