Antigen ID	TAR0KPFBI
Antigen Name	CD70 antigen (CD70)
Gene Name	CD70
Gene ID	970
Synonym	CD27L; CD27LG; TNFSF7; CD27 ligand;Tumor necrosis factor ligand superfamily member 7;CD_antigen=CD70
Sequence	MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN TDETFFGVQWVRP     Click to Show/Hide
Family	Tumor necrosis factor family
Function	Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.     Click to Show/Hide
Uniprot Entry	CD70_HUMAN
HGNC ID	HGNC:11937
KEGG ID	hsa:970

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AMG-172	Mertansine DM1	Microtubule (MT)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70-45 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70 mAb 1F4-IIIa-01	Anti-CD70 mAb 1F4-IIIa-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-01 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-02	Anti-CD70 mAb 1F4-IIIa-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-02 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-03	Anti-CD70 mAb 1F4-IIIa-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-03 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-04	Anti-CD70 mAb 1F4-IIIa-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-04 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-05	Anti-CD70 mAb 1F4-IIIa-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-05 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-06	Anti-CD70 mAb 1F4-IIIa-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-06 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-07	Anti-CD70 mAb 1F4-IIIa-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-07 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIa-08	Anti-CD70 mAb 1F4-IIIa-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-08 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-01	Anti-CD70 mAb 1F4-IIIb-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-01 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-02	Anti-CD70 mAb 1F4-IIIb-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-02 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-03	Anti-CD70 mAb 1F4-IIIb-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-03 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-04	Anti-CD70 mAb 1F4-IIIb-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-04 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-05	Anti-CD70 mAb 1F4-IIIb-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-05 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-06	Anti-CD70 mAb 1F4-IIIb-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-06 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-07	Anti-CD70 mAb 1F4-IIIb-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-07 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-08	Anti-CD70 mAb 1F4-IIIb-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-08 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIb-09	Anti-CD70 mAb 1F4-IIIb-09 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-09 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-01	Anti-CD70 mAb 1F4-IIIc-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-01 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-02	Anti-CD70 mAb 1F4-IIIc-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-02 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-03	Anti-CD70 mAb 1F4-IIIc-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-03 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-04	Anti-CD70 mAb 1F4-IIIc-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-04 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-05	Anti-CD70 mAb 1F4-IIIc-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-05 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-06	Anti-CD70 mAb 1F4-IIIc-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-06 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-07	Anti-CD70 mAb 1F4-IIIc-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-07 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-IIIc-08	Anti-CD70 mAb 1F4-IIIc-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-08 linker	[3]
ADC Info	Anti-CD70 mAb 1F4-A	Anti-CD70 mAb 1F4-A payload	Undisclosed	Anti-CD70 mAb 1F4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70 ADC 12-2	Anti-CD70 ADC 12-2 payload	Undisclosed	Anti-CD70 ADC 12-2 linker	[4]
ADC Info	Anti-CD70 ADC 2-7	Anti-CD70 ADC 2-7 payload	Undisclosed	Anti-CD70 ADC 2-7 linker	[4]
ADC Info	Anti-CD70 ADC 3-4	Anti-CD70 ADC 3-4 payload	Undisclosed	Anti-CD70 ADC 3-4 linker	[4]
ADC Info	Anti-CD70 ADC 4-3	Anti-CD70 ADC 4-3 payload	Undisclosed	Anti-CD70 ADC 4-3 linker	[4]
ADC Info	Anti-CD70 ADC 5-3	Anti-CD70 ADC 5-3 payload	Undisclosed	Anti-CD70 ADC 5-3 linker	[4]
ADC Info	Anti-CD70 ADC 6-2	Anti-CD70 ADC 6-2 payload	Undisclosed	Anti-CD70 ADC 6-2 linker	[4]
ADC Info	Anti-CD70 ADC 7-1	Anti-CD70 ADC 7-1 payload	Undisclosed	Anti-CD70 ADC 7-1 linker	[4]
ADC Info	Anti-CD70 ADC 8-5	Anti-CD70 ADC 8-5 payload	Undisclosed	Anti-CD70 ADC 8-5 linker	[4]
ADC Info	Anti-CD70 ADC 9-4	Anti-CD70 ADC 9-4 payload	Undisclosed	Anti-CD70 ADC 9-4 linker	[4]
ADC Info	Anti-CD70 ADC 10-1	Anti-CD70 ADC 10-1 payload	Undisclosed	Anti-CD70 ADC 10-1 linker	[4]
ADC Info	Anti-CD70 ADC 11-5	Anti-CD70 ADC 11-5 payload	Undisclosed	Anti-CD70 ADC 11-5 linker	[4]
ADC Info	Anti-CD70 ADC 12-3	Anti-CD70 ADC 12-3 payload	Undisclosed	Anti-CD70 ADC 12-3 linker	[4]
ADC Info	Anti-CD70 ADC 13-7	Anti-CD70 ADC 13-7 payload	Undisclosed	Anti-CD70 ADC 13-7 linker	[4]
ADC Info	Anti-CD70 ADC 14-5	Anti-CD70 ADC 14-5 payload	Undisclosed	Anti-CD70 ADC 14-5 linker	[4]
ADC Info	Anti-CD70 ADC 15-5	Anti-CD70 ADC 15-5 payload	Undisclosed	Anti-CD70 ADC 15-5 linker	[4]
ADC Info	Anti-CD70 ADC 16-5	Anti-CD70 ADC 16-5 payload	Undisclosed	Anti-CD70 ADC 16-5 linker	[4]
ADC Info	Anti-CD70 ADC 17-2	Anti-CD70 ADC 17-2 payload	Undisclosed	Anti-CD70 ADC 17-2 linker	[4]
ADC Info	Anti-CD70 ADC 18-3	Anti-CD70 ADC 18-3 payload	Undisclosed	Anti-CD70 ADC 18-3 linker	[4]
ADC Info	Anti-CD70 ADC 19-5	Anti-CD70 ADC 19-5 payload	Undisclosed	Anti-CD70 ADC 19-5 linker	[4]
ADC Info	Anti-CD70 ADC 21-5	Anti-CD70 ADC 21-5 payload	Undisclosed	Anti-CD70 ADC 21-5 linker	[4]
ADC Info	Anti-CD70 ADC 20-5	Anti-CD70 ADC 20-5 payload	Undisclosed	Anti-CD70 ADC 20-5 linker	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2007011968A2 c1F6-9a	Monomethyl auristatin E	Microtubule (MT)	WO2007011968A2_c1F6-9a linker	[5]
ADC Info	WO2007011968A2 c1F6-9b	Monomethyl auristatin F	Microtubule (MT)	WO2007011968A2_c1F6-9b linker	[5]
ADC Info	WO2007011968A2 c1F6-17	Doxorubicin	DNA topoisomerase 2-alpha (TOP2A)	WO2007011968A2_c1F6-17 linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015095755A1 h1F6-1.3	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_h1F6-1.3 linker	[6]
ADC Info	WO2015095755A1 h1F6-1006	WO2015095755A1_h1F6-1006 payload	Undisclosed	WO2015095755A1_h1F6-1006 linker	[6]
ADC Info	WO2015095755A1 h1F6-2.0	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_h1F6-2.0 linker	[6]
ADC Info	WO2015095755A1 h1F6-5.6	WO2015095755A1_h1F6-5.6 payload	Undisclosed	WO2015095755A1_h1F6-5.6 linker	[6]
ADC Info	WO2015095755A1 h1F6-6.4	WO2015095755A1_h1F6-6.4 payload	Undisclosed	WO2015095755A1_h1F6-6.4 linker	[6]
ADC Info	WO2015095755A1 h1F6-7.7	WO2015095755A1_h1F6-7.7 payload	Undisclosed	WO2015095755A1_h1F6-7.7 linker	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	h1F6-Compound 1	h1F6-compound 1 payload	Undisclosed	h1F6-compound 1 linker	[7]
ADC Info	h1F6-Compound 2	h1F6-compound 2 payload	Undisclosed	h1F6-compound 2 linker	[7]
ADC Info	h1F6-Compound 3	h1F6-compound 3 payload	Undisclosed	h1F6-compound 3 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	1F6-Val-Cit-PABC-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Val-Cit-PABC	[8]
ADC Info	1F6-Ile-Pro-AF	Auristatin F	Microtubule (MT)	Mal-Ile-Pro	[8]
ADC Info	1F6-Me3-Lys-Pro-AF	Auristatin F	Microtubule (MT)	Mal-Me3Lys-Pro	[8]
ADC Info	1F6-NorVal- (D)Asp-AF	Auristatin F	Microtubule (MT)	Mal-NorVal-D-Asp	[8]
ADC Info	1F6-beta-Ala- (D)Asp-AF	Auristatin F	Microtubule (MT)	Mal-bata-Ala-D-Asp	[8]
ADC Info	1F6-PhenylGly- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-PhenylGly-D-Lys	[8]
ADC Info	1F6-Met- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Met-D-Lys	[8]
ADC Info	1F6-Asn- (D)Lys-AM	Auristatin M	Microtubule (MT)	Mal-Asn-D-Lys	[8]
ADC Info	1F6-Met- (D)Lys-AW	L-Alanyl-L-tryptophan	Microtubule (MT)	Mal-Met-D-Lys	[8]
ADC Info	1F6-Ile-Val-AF	Auristatin F	Microtubule (MT)	Mal-Ile-Val	[8]
ADC Info	1F6-Asp-Val-AF	Auristatin F	Microtubule (MT)	Mal-Asp-Val	[8]
ADC Info	1F6-His-Val-AF	Auristatin F	Microtubule (MT)	Mal-His-Val	[8]
ADC Info	1F6-Met-Lys-AF	Auristatin F	Microtubule (MT)	Mal-Met-Lys	[8]
ADC Info	1F6-Asn-Lys-AF	Auristatin F	Microtubule (MT)	Mal-Asn-Lys	[8]
ADC Info	1F6-Pro- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Pro-D-Lys	[8]
ADC Info	1F6-Met- (D)Lys-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Met-D-Lys	[8]
ADC Info	1F6-Asn- (D)Lys-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Asn-D-Lys	[8]
ADC Info	1F6-Met- (D)Lys-AM	Auristatin M	Microtubule (MT)	Mal-Met-D-Lys	[8]
ADC Info	1F6-Asn- (D)Lys-AW	L-Alanyl-L-tryptophan	Microtubule (MT)	Mal-Asn-D-Lys	[8]
ADC Info	1F6-Asn- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Asn-D-Lys	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	m1F6-Compound 1	m1F6-compound 1 payload	Undisclosed	m1F6-compound 1 linker	[7]
ADC Info	m1F6-Compound 2	m1F6-compound 2 payload	Undisclosed	m1F6-compound 2 linker	[7]
ADC Info	m1F6-Compound 3	m1F6-compound 3 payload	Undisclosed	m1F6-compound 3 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD70-Mc-MMAF	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MDX-1203	Seco-MED-A	Human Deoxyribonucleic acid (hDNA)	Mal-Val-Cit	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD70-MMAF-ADC	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[11]
ADC Info	h1F6-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[12]
ADC Info	h1F6-MC-vc-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[12]
ADC Info	h1F6-MC-vc-PABC-MMAF DAR4	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[12]
ADC Info	h1F6-1 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Dpr-MA	[12]
ADC Info	h1F6-1 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Dpr-MA	[12]
ADC Info	h1F6-2 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MA	[12]
ADC Info	h1F6-2 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MA	[12]
ADC Info	h1F6-3 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Dpr-MA	[12]
ADC Info	h1F6-3 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Dpr-MA	[12]
ADC Info	h1F6-4 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MA	[12]
ADC Info	h1F6-4 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MA	[12]
ADC Info	h1F6-5 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-5 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-6 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-6 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-7 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Lys-MDpr	[12]
ADC Info	h1F6-7 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-Lys-MDpr	[12]
ADC Info	h1F6-8 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-Lys-MDpr	[12]
ADC Info	h1F6-9 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Glu-EDA-MDpr	[12]
ADC Info	h1F6-10 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-Glu-EDA-MDpr	[12]
ADC Info	h1F6-11 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-EDA-MDpr	[12]
ADC Info	h1F6-12 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thr-Ile-EDA-MDpr	[12]
ADC Info	h1F6-13 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[12]
ADC Info	h1F6-14 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-Ala-Lys-MDpr	[12]
ADC Info	h1F6-15 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Lys-MDpr	[12]
ADC Info	h1F6-16 MMAE	Monomethyl auristatin E	Microtubule (MT)	PhosphoThr-Ala-Lys-MDpr	[12]
ADC Info	h1F6-17 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-18 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-19 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-20 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-21 MMAE	Monomethyl auristatin E	Microtubule (MT)	hSer-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-22 MMAE	Monomethyl auristatin E	Microtubule (MT)	ValoH-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-23 MMAE	Monomethyl auristatin E	Microtubule (MT)	PhosphoThr-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-24 MMAE	Monomethyl auristatin E	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-25 MMAE	Monomethyl auristatin E	Microtubule (MT)	Triazole-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-26 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asn-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-27 MMAE	Monomethyl auristatin E	Microtubule (MT)	Asp-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-28 MMAE	Monomethyl auristatin E	Microtubule (MT)	Fur-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-29 MMAE	Monomethyl auristatin E	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-30 MMAE	Monomethyl auristatin E	Microtubule (MT)	Ser-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-31 MMAE	Monomethyl auristatin E	Microtubule (MT)	hSer-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-32 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-IleLeu-Dpr-MDpr	[12]
ADC Info	h1F6-33 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-Leu-Dpr-MDpr	[12]
ADC Info	h1F6-34 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Phe-Leu-Dpr-MDpr	[12]
ADC Info	h1F6-35 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-LeuPhe-Dpr-MDpr	[12]
ADC Info	h1F6-36 MMAE	Monomethyl auristatin E	Microtubule (MT)	Phe-Leu-Phe-Dpr-MDpr	[12]
ADC Info	h1F6-37 MMAE	Monomethyl auristatin E	Microtubule (MT)	Glu-Phe-Phe-Dpr-MDpr	[12]
ADC Info	h1F6-38 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-LysAla-Dpr-MDpr	[12]
ADC Info	h1F6-39 MMAE	Monomethyl auristatin E	Microtubule (MT)	Thr-Lys-Dpr-MDpr	[12]
ADC Info	h1F6-1 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Dpr-MA	[12]
ADC Info	h1F6-2 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-Dpr-MA	[12]
ADC Info	h1F6-3 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Dpr-MA	[12]
ADC Info	h1F6-4 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Dpr-MA	[12]
ADC Info	h1F6-5 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-6 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-7 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-Lys-MDpr	[12]
ADC Info	h1F6-8 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thiazole-Glu-Lys-MDpr	[12]
ADC Info	h1F6-9 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Glu-EDA-MDpr	[12]
ADC Info	h1F6-10 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Glu-EDA-MDpr	[12]
ADC Info	h1F6-11 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Ile-EDA-MDpr	[12]
ADC Info	h1F6-12 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Ile-EDA-MDpr	[12]
ADC Info	h1F6-13 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[12]
ADC Info	h1F6-14 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-Ala-Lys-MDpr	[12]
ADC Info	h1F6-15 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Lys-MDpr	[12]
ADC Info	h1F6-16 MMAF	Monomethyl auristatin F	Microtubule (MT)	PhosphoThr-Ala-Lys-MDpr	[12]
ADC Info	h1F6-17 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-18 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-19 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-20 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-21 MMAF	Monomethyl auristatin F	Microtubule (MT)	hSer-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-22 MMAF	Monomethyl auristatin F	Microtubule (MT)	ValoH-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-23 MMAF	Monomethyl auristatin F	Microtubule (MT)	PhosphoThr-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-24 MMAF	Monomethyl auristatin F	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-25 MMAF	Monomethyl auristatin F	Microtubule (MT)	Triazole-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-26 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asn-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-27 MMAF	Monomethyl auristatin F	Microtubule (MT)	Asp-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-28 MMAF	Monomethyl auristatin F	Microtubule (MT)	Fur-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-29 MMAF	Monomethyl auristatin F	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-30 MMAF	Monomethyl auristatin F	Microtubule (MT)	Ser-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-31 MMAF	Monomethyl auristatin F	Microtubule (MT)	hSer-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-32 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-IleLeu-Dpr-MDpr	[12]
ADC Info	h1F6-33 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Ile-Leu-Dpr-MDpr	[12]
ADC Info	h1F6-34 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Phe-Leu-Dpr-MDpr	[12]
ADC Info	h1F6-35 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-LeuPhe-Dpr-MDpr	[12]
ADC Info	h1F6-36 MMAF	Monomethyl auristatin F	Microtubule (MT)	Phe-Leu-Phe-Dpr-MDpr	[12]
ADC Info	h1F6-37 MMAF	Monomethyl auristatin F	Microtubule (MT)	Glu-Phe-Phe-Dpr-MDpr	[12]
ADC Info	h1F6-38 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-LysAla-Dpr-MDpr	[12]
ADC Info	h1F6-39 MMAF	Monomethyl auristatin F	Microtubule (MT)	Thr-Lys-Dpr-MDpr	[12]
ADC Info	h1F6-MC-vc-PABC-MMAF DAR8	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[12]
ADC Info	h1F6-13 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thiazole-Glu-EDA-MDpr	[12]
ADC Info	h1F6-12 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Thr-Ile-EDA-MDpr	[12]
ADC Info	h1F6-11 MMAE DAR8	Monomethyl auristatin E	Microtubule (MT)	Phe-Ile-EDA-MDpr	[12]
ADC Info	h1F6-17 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Asn-AlaGlu-Dpr-MDpr	[12]
ADC Info	h1F6-20 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Glu-Ala-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-24 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	Pyrazole-Glu-Dpr-MDpr	[12]
ADC Info	h1F6-29 MMAE DAR4	Monomethyl auristatin E	Microtubule (MT)	ValOH-Glu-Dpr-MDpr	[12]
ADC Info	Vorsetuzumab mafodotin	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[13]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PRO-1160	Exatecan	DNA topoisomerase 1 (TOP1)	Cys-11 ADC linker	[14]
ADC Info	ARX-305	Undisclosed	Undisclosed	Undisclosed	[15]
ADC Info	CD70-glucocorticoid ADC	Fluticasone propionate	Glucocorticoid receptor (NR3C1)	Pyrophosphate linker	[16]
ADC Info	Anti-CD70 antibody-drug conjugate (XDCExplorer)	Undisclosed	Undisclosed	Undisclosed	[17]
ADC Info	SGN-CD70A	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Undisclosed	[18]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.37E-09; Fold-change: 0.23750405; Z-score: 0.833646569
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.944591191; Fold-change: -0.124328097; Z-score: -0.623539676
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.296821774; Fold-change: 0.008460034; Z-score: 0.0275707
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.107396488; Fold-change: -0.240458099; Z-score: -0.760507704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.22E-24; Fold-change: -0.201168492; Z-score: -0.780207153
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.256904399; Fold-change: 0.028415902; Z-score: 0.151097969
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.639824598; Fold-change: 0.052777286; Z-score: 0.307799235
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.685058632; Fold-change: -0.015234703; Z-score: -0.069104482
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.06928947; Fold-change: -0.279343794; Z-score: -1.509558407
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.03297748; Fold-change: -0.381742447; Z-score: -0.903711874
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.634430958; Fold-change: -0.165798519; Z-score: -1.301898
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.599070617; Fold-change: 0.05906427; Z-score: 0.131697646
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-06; Fold-change: 0.094885138; Z-score: 0.422294857
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.008232536; Fold-change: 0.064131693; Z-score: 0.231928031
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.154293126; Fold-change: -0.087780047; Z-score: -0.193735315
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.29E-09; Fold-change: -0.412074412; Z-score: -0.845854312
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.75E-10; Fold-change: -0.283005949; Z-score: -1.249430279
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.04E-18; Fold-change: -0.209691996; Z-score: -0.848284074
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.059981678; Fold-change: -0.350218619; Z-score: -1.548397323
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.553534995; Fold-change: 0.041268023; Z-score: 0.134326403
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003968516; Fold-change: 0.032888585; Z-score: 0.123779959
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.743977343; Fold-change: -0.175865047; Z-score: -0.427961713
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000451932; Fold-change: -0.145394142; Z-score: -0.404159227
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.022315819; Fold-change: -0.347372729; Z-score: -2.68782675
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.885048994; Fold-change: 0.085923668; Z-score: 0.212718805
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.71651679; Fold-change: 0.091508804; Z-score: 0.27284419
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.813029236; Fold-change: 0.009587821; Z-score: 0.030097291
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.87E-06; Fold-change: 0.266657282; Z-score: 1.702349205
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.07E-08; Fold-change: 0.219803323; Z-score: 1.338098708
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.69E-18; Fold-change: 0.30938461; Z-score: 1.041461445
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.015320501; Fold-change: 0.071001107; Z-score: 0.71137971
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000128867; Fold-change: -0.529515252; Z-score: -1.524134541
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.240056403; Fold-change: 0.100707108; Z-score: 0.671577104
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128374573; Fold-change: 0.129806686; Z-score: 0.911268646
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.60E-09; Fold-change: 0.174188158; Z-score: 0.526053819
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.74E-13; Fold-change: 0.224938282; Z-score: 1.337005465
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.638833026; Fold-change: -0.026805528; Z-score: -0.190257033
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.74E-12; Fold-change: 0.268481975; Z-score: 0.958367452
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.445422064; Fold-change: -0.026463497; Z-score: -0.145436792
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.049324001; Fold-change: 0.057461193; Z-score: 0.289861841
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.676480355; Fold-change: 0.041811326; Z-score: 0.068350163
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.421348307; Fold-change: 0.012197138; Z-score: 0.02482372
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.107819953; Fold-change: -0.161364812; Z-score: -2.031869674
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.034517818; Fold-change: -0.188379494; Z-score: -0.652847613
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.325489898; Fold-change: 0.00289254; Z-score: 0.021550329
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.181533279; Fold-change: -0.066263277; Z-score: -0.897859436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.179794171; Fold-change: 0.109279428; Z-score: 0.456649907
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.921399797; Fold-change: -0.063190059; Z-score: -0.359965999
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.028592619; Fold-change: -0.102468728; Z-score: -0.600367449
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054246247; Fold-change: -0.0683143; Z-score: -0.419415852
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.650052834; Fold-change: -0.016599487; Z-score: -0.157926573
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.098930452; Fold-change: 0.462346823; Z-score: 1.240312163
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.855587537; Fold-change: 0.044065782; Z-score: 0.178161975
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.401187587; Fold-change: -0.025202715; Z-score: -0.098670256
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.478968668; Fold-change: -0.022392567; Z-score: -0.086589329
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.592109307; Fold-change: 0.030463482; Z-score: 0.206999056
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.214990384; Fold-change: 0.39378589; Z-score: 1.499472431
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.341724863; Fold-change: 0.165425348; Z-score: 0.322484785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.498161652; Fold-change: -0.112685735; Z-score: -0.547068076
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.259719701; Fold-change: 0.057464388; Z-score: 0.202998545
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.065366303; Fold-change: 0.090565972; Z-score: 0.462078942
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.647587712; Fold-change: -0.088139256; Z-score: -0.305972652
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.237691864; Fold-change: 0.117713429; Z-score: 0.947907172
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.10858373; Fold-change: -0.202455955; Z-score: -0.994942514
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006472113; Fold-change: 0.260031861; Z-score: 3.373450789
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033692129; Fold-change: 0.101551121; Z-score: 0.71789763
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.288189846; Fold-change: 0.105397164; Z-score: 0.448875397
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.35E-05; Fold-change: 0.209170532; Z-score: 0.969029734
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.552177907; Fold-change: -0.057484319; Z-score: -0.230938717
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.917896705; Fold-change: -0.022405905; Z-score: -0.201375919
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.185426239; Fold-change: -0.181575027; Z-score: -1.106974531
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.07E-09; Fold-change: 0.221882032; Z-score: 0.844108601
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.021676621; Fold-change: 0.135963038; Z-score: 1.801565879
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.068424499; Fold-change: -0.132991049; Z-score: -0.796388136
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.896623955; Fold-change: 0.162674831; Z-score: 0.415945862
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.677179844; Fold-change: 0.000165601; Z-score: 0.000871468
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079279291; Fold-change: -0.090628259; Z-score: -0.616771124
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.92E-14; Fold-change: -0.497514186; Z-score: -0.974353583
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.17E-14; Fold-change: 0.704554845; Z-score: 1.789309817
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.226227075; Fold-change: 0.252847427; Z-score: 0.615901171
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.583909856; Fold-change: 0.023311594; Z-score: 0.122729509
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.778250493; Fold-change: -0.005586626; Z-score: -0.134955402
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.599844122; Fold-change: -0.103086567; Z-score: -0.216837057
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.785369427; Fold-change: -0.008663818; Z-score: -0.056500574
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000446547; Fold-change: 0.152238645; Z-score: 0.606474752
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.565643772; Fold-change: -0.124030352; Z-score: -0.180244594
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.044832891; Fold-change: -0.139964854; Z-score: -1.332955578
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.859618754; Fold-change: 0.281041969; Z-score: 0.299172031
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.883536692; Fold-change: 0.022824831; Z-score: 0.080629273
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002032443; Fold-change: 0.295260568; Z-score: 2.274319635
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.042769547; Fold-change: -0.23289768; Z-score: -0.88558886
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.07E-15; Fold-change: 0.119651191; Z-score: 0.57864228
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022460893; Fold-change: 0.169054939; Z-score: 0.818982916
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.908750874; Fold-change: 0.143886814; Z-score: 0.10180355
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007228515; Fold-change: -0.215545871; Z-score: -0.543880304
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000166678; Fold-change: 0.19945083; Z-score: 0.583791451
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.645077252; Fold-change: -0.092107949; Z-score: -0.528294333
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.720450651; Fold-change: -0.011888992; Z-score: -0.092315299
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.378679409; Fold-change: 0.103319986; Z-score: 0.379697184
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.18E-15; Fold-change: -0.60670709; Z-score: -1.042532844
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.32E-09; Fold-change: 0.399857001; Z-score: 0.73247132
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.53E-09; Fold-change: 0.760442618; Z-score: 2.838597859
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.55E-15; Fold-change: 0.530662477; Z-score: 1.223808077
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.691774325; Fold-change: 0.024357467; Z-score: 0.111240685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.326468562; Fold-change: 0.058558833; Z-score: 0.529156537
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.67771948; Fold-change: 0.004732237; Z-score: 0.047335724
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.025303891; Fold-change: 0.187789279; Z-score: 1.067160433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.72619028; Fold-change: 0.148298157; Z-score: 0.485448848
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.785294764; Fold-change: -0.031117895; Z-score: -0.163755511
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.453749139; Fold-change: -0.035554451; Z-score: -0.164904834
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.388523644; Fold-change: -0.025261953; Z-score: -0.240341034
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.100650162; Fold-change: -0.263039421; Z-score: -1.48428833
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.084057543; Fold-change: -0.090100616; Z-score: -0.479130433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.857148566; Fold-change: 0.027523232; Z-score: 0.159531958
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.810479208; Fold-change: -0.038589129; Z-score: -0.300335612
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.22461013; Fold-change: -0.064156387; Z-score: -0.402103219
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.701099178; Fold-change: 0.044226419; Z-score: 0.150109647
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.19172148; Fold-change: -0.212133177; Z-score: -1.137335211
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.53945386; Fold-change: 0.007080026; Z-score: 0.087764489
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027437606; Fold-change: -0.133990608; Z-score: -0.631734306
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.251525355; Fold-change: -0.011369707; Z-score: -0.04812893
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.816749426; Fold-change: 0.051519886; Z-score: 0.177510847
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.896760134; Fold-change: 0.043644093; Z-score: 0.195416356
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.54206812; Fold-change: -0.021169133; Z-score: -0.150616497
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.584043066; Fold-change: 0.023330874; Z-score: 0.11344192
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.884547504; Fold-change: 0.042495384; Z-score: 0.254134797
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002169567; Fold-change: 0.244236706; Z-score: 1.492422026
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.68E-06; Fold-change: -0.504548695; Z-score: -2.217506406
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.042628875; Fold-change: -0.279224546; Z-score: -1.490340166
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	First-in-human multicenter phase I study of BMS-936561 (MDX-1203), an antibody-drug conjugate targeting CD70. Cancer Chemother Pharmacol. 2016 Jan;77(1):155-62.
Ref 2	Design, Synthesis, and Structure-Activity Relationships of Novel Tetrahydroisoquinolino Benzodiazepine Dimer Antitumor Agents and Their Application in Antibody-Drug Conjugates. J Med Chem. 2020 Nov 25;63(22):13913-13950. doi: 10.1021/acs.jmedchem.0c01385.
Ref 3	Benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 4	Phosphate based linkers for intracellular delivery of drug conjugates; 2015-10-08.
Ref 5	Beta-glucuronide-linker drug conjugates; 2007-10-25.
Ref 6	Methylene carbamate linkers for use with targeted-drug conjugates; 2015-06-25.
Ref 7	Cyclodextrin and antibody-drug conjugate formulations.
Ref 8	Novel peptide linkers for highly potent antibody-auristatin conjugate. Bioconjug Chem. 2008 Oct;19(10):1960-3. doi: 10.1021/bc800289a. Epub 2008 Sep 20.
Ref 9	Introduction to basic information on ADC drug Alpha-CD70-Mc-MMAF
Ref 10	A phase 2 study of the cytotoxic immunoconjugate CMB-401 (hCTM01-calicheamicin) in patients with platinum-sensitive recurrent epithelial ovarian carcinoma. Cancer Immunol Immunother. 2003 Apr;52(4):243-8.
Ref 11	CD70 antibody-drug conjugate as a potential therapeutic agent for uterine leiomyosarcoma. Am J Obstet Gynecol. 2021 Feb;224(2):197.e1-197.e23. doi: 10.1016/j.ajog.2020.08.028. Epub 2020 Aug 19.
Ref 12	Hydrophilic antibody-drug conjugates; 2015-08-20.
Ref 13	Phase I dose-escalation study of SGN-75 in patients with CD70-positive relapsed/refractory non-Hodgkin lymphoma or metastatic renal cell carcinoma. Invest New Drugs. 2014 Dec;32(6):1246-57. doi: 10.1007/s10637-014-0151-0. Epub 2014 Aug 22.
Ref 14	PRO1160, a novel CD70-directed antibody-drug conjugate, demonstrates robust anti-tumor activity in mouse models of renal cell carcinoma and non-Hodgkin lymphoma. Cancer Res (2022) 82 (12_Supplement): 1759.
Ref 15	Ambrx biopharmaceutical company product pipeline.
Ref 16	Discovery of Pyrophosphate Diesters as Tunable, Soluble, and Bioorthogonal Linkers for Site-Specific Antibody-Drug Conjugates. J Am Chem Soc. 2016 Feb 3;138(4):1430-45. doi: 10.1021/jacs.5b12547. Epub 2016 Jan 25.
Ref 17	Introduction to basic information on anti-CD70 antibody-drug conjugate(XDCExplorer).
Ref 18	A phase 1 trial of SGN-CD70A in patients with CD70-positive, metastatic renal cell carcinoma. Cancer. 2019 Apr 1;125(7):1124-1132. doi: 10.1002/cncr.31912. Epub 2019 Jan 9.