Antigen ID	TAR0KPFBI
Antigen Name	CD70 antigen (CD70)
Gene Name	CD70
Gene ID	970
Synonym	CD27L; CD27LG; TNFSF7; CD27 ligand;Tumor necrosis factor ligand superfamily member 7;CD_antigen=CD70
Sequence	MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN TDETFFGVQWVRP     Click to Show/Hide
Family	Tumor necrosis factor family
Function	Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.     Click to Show/Hide
Uniprot Entry	CD70_HUMAN
HGNC ID	HGNC:11937
KEGG ID	hsa:970

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2024092067A1 ADC 2E7-LD003 (PA003)	undisclosed	Undisclosed	Drug linker PB003	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD004 (PA004)	undisclosed	Undisclosed	Drug linker PB004	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD008 (PA008)	undisclosed	Undisclosed	Drug linker PB008	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD038 (PA038)	undisclosed	Undisclosed	Drug linker PB038	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD039 (PA039)	undisclosed	Undisclosed	Drug linker PB039	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD040 (PA040)	undisclosed	Undisclosed	Drug linker PB040	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD082 (PA082)	undisclosed	Undisclosed	Drug linker PB082	[1]
ADC Info	WO2024092067A1 ADC 2E7-LD083 (PA083)	undisclosed	Undisclosed	Drug linker PB083	[1]
ADC Info	WO2024092067A1 2E7-deruxtecan	DX-8951 derivative (DXd)	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly	[1]
ADC Info	WO2024092067A1 2E7-vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	US12186310B2-35	Undisclosed	Undisclosed	Undisclosed	[2]
ADC Info	US12186310B2-36	Undisclosed	Undisclosed	Undisclosed	[2]
ADC Info	US12186310B2-37	Undisclosed	Undisclosed	Undisclosed	[2]
ADC Info	US12186310B2-49	Undisclosed	Undisclosed	Undisclosed	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	US12186310B2-10	Undisclosed	Undisclosed	Undisclosed	[2]
ADC Info	US12186310B2-11	Undisclosed	Undisclosed	Undisclosed	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PRO1160	Exatecan	DNA topoisomerase 1 (TOP1)	T1000

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AMG 172	DM1	Microtubule (MT)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
ADC Info	Anti-CD70-45 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Cit-PABC	[3]
ADC Info	ARX305	Amberstatin 269 (AS269)	Microtubule (MT)	Oxime-PEG3

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70 mAb 1F4-IIIa-01	Anti-CD70 mAb 1F4-IIIa-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-01 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-02	Anti-CD70 mAb 1F4-IIIa-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-02 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-03	Anti-CD70 mAb 1F4-IIIa-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-03 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-04	Anti-CD70 mAb 1F4-IIIa-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-04 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-05	Anti-CD70 mAb 1F4-IIIa-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-05 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-06	Anti-CD70 mAb 1F4-IIIa-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-06 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-07	Anti-CD70 mAb 1F4-IIIa-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-07 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIa-08	Anti-CD70 mAb 1F4-IIIa-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIa-08 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-01	Anti-CD70 mAb 1F4-IIIb-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-01 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-02	Anti-CD70 mAb 1F4-IIIb-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-02 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-03	Anti-CD70 mAb 1F4-IIIb-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-03 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-04	Anti-CD70 mAb 1F4-IIIb-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-04 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-05	Anti-CD70 mAb 1F4-IIIb-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-05 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-06	Anti-CD70 mAb 1F4-IIIb-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-06 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-07	Anti-CD70 mAb 1F4-IIIb-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-07 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-08	Anti-CD70 mAb 1F4-IIIb-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-08 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIb-09	Anti-CD70 mAb 1F4-IIIb-09 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIb-09 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-01	Anti-CD70 mAb 1F4-IIIc-01 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-01 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-02	Anti-CD70 mAb 1F4-IIIc-02 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-02 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-03	Anti-CD70 mAb 1F4-IIIc-03 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-03 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-04	Anti-CD70 mAb 1F4-IIIc-04 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-04 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-05	Anti-CD70 mAb 1F4-IIIc-05 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-05 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-06	Anti-CD70 mAb 1F4-IIIc-06 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-06 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-07	Anti-CD70 mAb 1F4-IIIc-07 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-07 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-IIIc-08	Anti-CD70 mAb 1F4-IIIc-08 payload	Undisclosed	Anti-CD70 mAb 1F4-IIIc-08 linker	[4]
ADC Info	Anti-CD70 mAb 1F4-A	Anti-CD70 mAb 1F4-A payload	Undisclosed	Anti-CD70 mAb 1F4 linker	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70 ADC 12-2	Anti-CD70 ADC 12-2 payload	Undisclosed	Anti-CD70 ADC 12-2 linker	[5]
ADC Info	Anti-CD70 ADC 2-7	Anti-CD70 ADC 2-7 payload	Undisclosed	Anti-CD70 ADC 2-7 linker	[5]
ADC Info	Anti-CD70 ADC 3-4	Anti-CD70 ADC 3-4 payload	Undisclosed	Anti-CD70 ADC 3-4 linker	[5]
ADC Info	Anti-CD70 ADC 4-3	Anti-CD70 ADC 4-3 payload	Undisclosed	Anti-CD70 ADC 4-3 linker	[5]
ADC Info	Anti-CD70 ADC 5-3	Anti-CD70 ADC 5-3 payload	Undisclosed	Anti-CD70 ADC 5-3 linker	[5]
ADC Info	Anti-CD70 ADC 6-2	Anti-CD70 ADC 6-2 payload	Undisclosed	Anti-CD70 ADC 6-2 linker	[5]
ADC Info	Anti-CD70 ADC 7-1	Anti-CD70 ADC 7-1 payload	Undisclosed	Anti-CD70 ADC 7-1 linker	[5]
ADC Info	Anti-CD70 ADC 8-5	Anti-CD70 ADC 8-5 payload	Undisclosed	Anti-CD70 ADC 8-5 linker	[5]
ADC Info	Anti-CD70 ADC 9-4	Anti-CD70 ADC 9-4 payload	Undisclosed	Anti-CD70 ADC 9-4 linker	[5]
ADC Info	Anti-CD70 ADC 10-1	Anti-CD70 ADC 10-1 payload	Undisclosed	Anti-CD70 ADC 10-1 linker	[5]
ADC Info	Anti-CD70 ADC 11-5	Anti-CD70 ADC 11-5 payload	Undisclosed	Anti-CD70 ADC 11-5 linker	[5]
ADC Info	Anti-CD70 ADC 12-3	Anti-CD70 ADC 12-3 payload	Undisclosed	Anti-CD70 ADC 12-3 linker	[5]
ADC Info	Anti-CD70 ADC 13-7	Anti-CD70 ADC 13-7 payload	Undisclosed	Anti-CD70 ADC 13-7 linker	[5]
ADC Info	Anti-CD70 ADC 14-5	Anti-CD70 ADC 14-5 payload	Undisclosed	Anti-CD70 ADC 14-5 linker	[5]
ADC Info	Anti-CD70 ADC 15-5	Anti-CD70 ADC 15-5 payload	Undisclosed	Anti-CD70 ADC 15-5 linker	[5]
ADC Info	Anti-CD70 ADC 16-5	Anti-CD70 ADC 16-5 payload	Undisclosed	Anti-CD70 ADC 16-5 linker	[5]
ADC Info	Anti-CD70 ADC 17-2	Anti-CD70 ADC 17-2 payload	Undisclosed	Anti-CD70 ADC 17-2 linker	[5]
ADC Info	Anti-CD70 ADC 18-3	Anti-CD70 ADC 18-3 payload	Undisclosed	Anti-CD70 ADC 18-3 linker	[5]
ADC Info	Anti-CD70 ADC 19-5	Anti-CD70 ADC 19-5 payload	Undisclosed	Anti-CD70 ADC 19-5 linker	[5]
ADC Info	Anti-CD70 ADC 20-5	Anti-CD70 ADC 20-5 payload	Undisclosed	Anti-CD70 ADC 20-5 linker	[5]
ADC Info	Anti-CD70 ADC 21-5	Anti-CD70 ADC 21-5 payload	Undisclosed	Anti-CD70 ADC 21-5 linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2007011968A2 c1F6-9a	Monomethyl auristatin E	Microtubule (MT)	WO2007011968A2_c1F6-9a linker	[6]
ADC Info	WO2007011968A2 c1F6-9b	Monomethyl auristatin F	Microtubule (MT)	WO2007011968A2_c1F6-9b linker	[6]
ADC Info	WO2007011968A2 c1F6-17	Doxorubicin	DNA topoisomerase 2-alpha (TOP2A)	WO2007011968A2_c1F6-17 linker	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015095755A1 h1F6-1.3	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_h1F6-1.3 linker	[7]
ADC Info	WO2015095755A1 h1F6-1006	WO2015095755A1_h1F6-1006 payload	Undisclosed	WO2015095755A1_h1F6-1006 linker	[7]
ADC Info	WO2015095755A1 h1F6-2.0	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_h1F6-2.0 linker	[7]
ADC Info	WO2015095755A1 h1F6-5.6	WO2015095755A1_h1F6-5.6 payload	Undisclosed	WO2015095755A1_h1F6-5.6 linker	[7]
ADC Info	WO2015095755A1 h1F6-6.4	WO2015095755A1_h1F6-6.4 payload	Undisclosed	WO2015095755A1_h1F6-6.4 linker	[7]
ADC Info	WO2015095755A1 h1F6-7.7	WO2015095755A1_h1F6-7.7 payload	Undisclosed	WO2015095755A1_h1F6-7.7 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	h1F6-Compound 1	h1F6-compound 1 payload	Undisclosed	h1F6-compound 1 linker	[8]
ADC Info	h1F6-Compound 2	h1F6-compound 2 payload	Undisclosed	h1F6-compound 2 linker	[8]
ADC Info	h1F6-Compound 3	h1F6-compound 3 payload	Undisclosed	h1F6-compound 3 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	1F6-Val-Cit-PABC-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Val-Cit-PABC	[9]
ADC Info	1F6-Ile-Pro-AF	Auristatin F	Microtubule (MT)	Mal-Ile-Pro	[9]
ADC Info	1F6-Me3-Lys-Pro-AF	Auristatin F	Microtubule (MT)	Mal-Me3Lys-Pro	[9]
ADC Info	1F6-NorVal- (D)Asp-AF	Auristatin F	Microtubule (MT)	Mal-NorVal-D-Asp	[9]
ADC Info	1F6-beta-Ala- (D)Asp-AF	Auristatin F	Microtubule (MT)	Mal-bata-Ala-D-Asp	[9]
ADC Info	1F6-PhenylGly- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-PhenylGly-D-Lys	[9]
ADC Info	1F6-Met- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Met-D-Lys	[9]
ADC Info	1F6-Asn- (D)Lys-AM	Auristatin M	Microtubule (MT)	Mal-Asn-D-Lys	[9]
ADC Info	1F6-Met- (D)Lys-AW	L-Alanyl-L-tryptophan	Microtubule (MT)	Mal-Met-D-Lys	[9]
ADC Info	1F6-Ile-Val-AF	Auristatin F	Microtubule (MT)	Mal-Ile-Val	[9]
ADC Info	1F6-Asp-Val-AF	Auristatin F	Microtubule (MT)	Mal-Asp-Val	[9]
ADC Info	1F6-His-Val-AF	Auristatin F	Microtubule (MT)	Mal-His-Val	[9]
ADC Info	1F6-Met-Lys-AF	Auristatin F	Microtubule (MT)	Mal-Met-Lys	[9]
ADC Info	1F6-Asn-Lys-AF	Auristatin F	Microtubule (MT)	Mal-Asn-Lys	[9]
ADC Info	1F6-Pro- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Pro-D-Lys	[9]
ADC Info	1F6-Met- (D)Lys-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Met-D-Lys	[9]
ADC Info	1F6-Asn- (D)Lys-MMAF	Monomethyl auristatin F	Microtubule (MT)	Mal-Asn-D-Lys	[9]
ADC Info	1F6-Met- (D)Lys-AM	Auristatin M	Microtubule (MT)	Mal-Met-D-Lys	[9]
ADC Info	1F6-Asn- (D)Lys-AW	L-Alanyl-L-tryptophan	Microtubule (MT)	Mal-Asn-D-Lys	[9]
ADC Info	1F6-Asn- (D)Lys-AF	Auristatin F	Microtubule (MT)	Mal-Asn-D-Lys	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	m1F6-Compound 1	m1F6-compound 1 payload	Undisclosed	m1F6-compound 1 linker	[8]
ADC Info	m1F6-Compound 2	m1F6-compound 2 payload	Undisclosed	m1F6-compound 2 linker	[8]
ADC Info	m1F6-Compound 3	m1F6-compound 3 payload	Undisclosed	m1F6-compound 3 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD70-Mc-MMAF	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	TW201803600A ADC-6	PBD	Undisclosed	Undisclosed	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SGN-CD70A	PBD dimer	Human deoxyribonucleic acid (hDNA)	dipeptide linker

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ARX-305	Monomethyl auristatin F	Microtubule (MT)	Oxime-PEG3

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	BMS-936561	Seco-MED-A	Human deoxyribonucleic acid (hDNA)	Mal-Val-Cit

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Vorsetuzumab mafodotin	MMAF	Microtubule (MT)	Maleimido-caproyl
ADC Info	CD70-MMAF-ADC	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD70 antibody-drug conjugate (XDCExplorer)	Undisclosed	Undisclosed	Undisclosed	[13]
ADC Info	CD70-glucocorticoid ADC	Fluticasone propionate	Glucocorticoid receptor (NR3C1)	Pyrophosphate linker	[14]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105899515B III	Undisclosed	Undisclosed	Undisclosed	[15]

Ref 1	CD70 antibody drug conjugates and methods of using the same
Ref 2	Antibody-drug conjugate
Ref 3	Design, Synthesis, and Structure-Activity Relationships of Novel Tetrahydroisoquinolino Benzodiazepine Dimer Antitumor Agents and Their Application in Antibody-Drug Conjugates. J Med Chem. 2020 Nov 25;63(22):13913-13950. doi: 10.1021/acs.jmedchem.0c01385.
Ref 4	Benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 5	Phosphate based linkers for intracellular delivery of drug conjugates; 2015-10-08.
Ref 6	Beta-glucuronide-linker drug conjugates; 2007-10-25.
Ref 7	Methylene carbamate linkers for use with targeted-drug conjugates; 2015-06-25.
Ref 8	Cyclodextrin and antibody-drug conjugate formulations.
Ref 9	Novel peptide linkers for highly potent antibody-auristatin conjugate. Bioconjug Chem. 2008 Oct;19(10):1960-3. doi: 10.1021/bc800289a. Epub 2008 Sep 20.
Ref 10	Introduction to basic information on ADC drug Alpha-CD70-Mc-MMAF
Ref 11	Antibody-drug conjugates mainly based on PBD and combinations with FLT3 inhibitors
Ref 12	CD70 antibody-drug conjugate as a potential therapeutic agent for uterine leiomyosarcoma. Am J Obstet Gynecol. 2021 Feb;224(2):197.e1-197.e23. doi: 10.1016/j.ajog.2020.08.028. Epub 2020 Aug 19.
Ref 13	Introduction to basic information on anti-CD70 antibody-drug conjugate(XDCExplorer).
Ref 14	Discovery of Pyrophosphate Diesters as Tunable, Soluble, and Bioorthogonal Linkers for Site-Specific Antibody-Drug Conjugates. J Am Chem Soc. 2016 Feb 3;138(4):1430-45. doi: 10.1021/jacs.5b12547. Epub 2016 Jan 25.
Ref 15	Derivatives of uncialamycin, methods of synthesis and uses as antitumor agents