Antibody Information
General Information of This Antibody
| Antibody ID | ANI0DSHWS |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-CD70 mAb c1F6 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Chimeric IgG1-kappa |
|||||
| Antigen Name | CD70 antigen (CD70) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYEESNRYH
ADSVKGRFTISRDNSKITLYLQMNSLRTEDTAVYYCARDGGIAAPGPDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYA STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMTQSPLSLTVTPGEPASISCRSSQSLLYSNGYNYLDWYLQKPGQSPQVLISLGSNRA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQARQTPFTFGPGTKVDIRRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2007011968A2 c1F6-9a [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0.00% (Day 27) | Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-) | ||
| Method Description |
An in vivo therapy experiments with c1F6-9a was undertaken in nude mice with subcutaneous Karpas 299 ALCL tumors. The animals (5 per group)were treated with a single intravenous dose of c1F6-9a at 3 mg/kg (mAb component) on day 14.
|
||||
| In Vivo Model | Karpas-299 CDX model | ||||
| In Vitro Model | ALK-positive anaplastic large cell lymphoma | Karpas-299 cells | CVCL_1324 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.45 nM
|
Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 30.00 nM | Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | ALK-positive anaplastic large cell lymphoma | Karpas-299 cells | CVCL_1324 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 50.00 nM | Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
WO2007011968A2 c1F6-9b [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 86.08% (Day 41) | Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
An in vivo therapy experiments with c1F6-9b was undertaken in nude mice with subcutaneous 786-O cells. The animals (5 per group)were treated with a single intravenous dose of c1F6-9b at 0.75 mg/kg (mAb component) on day 14.
|
||||
| In Vivo Model | 786-O CDX model | ||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 89.93% (Day 41) | Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
An in vivo therapy experiments with c1F6-9b was undertaken in nude mice with subcutaneous 786-O cells. The animals (5 per group)were treated with a single intravenous dose of c1F6-9b at 1.5 mg/kg (mAb component) on day 14.
|
||||
| In Vivo Model | 786-O CDX model | ||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94.00% (Day 41) | Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
An in vivo therapy experiments with c1F6-9b was undertaken in nude mice with subcutaneous 786-O cells. The animals (5 per group)were treated with a single intravenous dose of c1F6-9b at 3 mg/kg (mAb component) on day 14.
|
||||
| In Vivo Model | 786-O CDX model | ||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.08 nM
|
Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.20 nM
|
Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 50.00 nM | Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | ALK-positive anaplastic large cell lymphoma | Karpas-299 cells | CVCL_1324 | ||
WO2007011968A2 c1F6-17 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.00 nM
|
Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Clear cell renal cell carcinoma | Caki-1 cells | CVCL_0234 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.70 nM
|
Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | Renal cell carcinoma | 786-O cells | CVCL_1051 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 55.00 nM | Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-) | ||
| Method Description |
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
|
||||
| In Vitro Model | ALK-positive anaplastic large cell lymphoma | Karpas-299 cells | CVCL_1324 | ||
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.