Antigen ID	TAR0NEZUA
Antigen Name	Mesothelin (MSLN)
Gene Name	MSLN
Gene ID	10232
Synonym	MPF; CAK1 antigen;Pre-pro-megakaryocyte-potentiating factor
Sequence	MALP.PLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLS PRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDL LLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADV RALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSV STMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTAC PSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQ GYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVATL IDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLD VLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPL TVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQ EALSGTPCLLGPGPVLTVLALLLASTLA     Click to Show/Hide
Family	LAMP family
Function	Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) potentiates megakaryocyte colony formation in vitro.     Click to Show/Hide
Uniprot Entry	MSLN_HUMAN
HGNC ID	HGNC:7371
KEGG ID	hsa:10232

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	DMOT4039A	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MSLN-Mal-PEG2-Val-Cit-PABC-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG2-Val-Cit-PABC	[2]
ADC Info	MSLN-Mal-PEG8-Val-Cit-PABC-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG8-Val-Cit-PABC	[2]
ADC Info	MSLN-Mal-Caproyl-Val-Cit-PABC-Eribulin	Eribulin	Microtubule (MT)	Maleimide-Caproyl-Val-Cit-PABC	[2]
ADC Info	MSLN-Mal-PEG2-Ala-Ala-Asn-PABC-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG2-Ala-Ala-Asn-PABC	[2]
ADC Info	MSLN-Mal-PEG4-tria-PEG3-Dis-dim-PABC-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG4-triazole-PEG3-Disulfidyl-dimethyl-PABC	[2]
ADC Info	MSLN-Mal-PEG4-tria-PEG3-Sulfo-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG4-triazole-PEG3-Sulfonamide	[2]
ADC Info	MSLN-Mal-PEG2-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG2	[2]
ADC Info	MSLN-Mal-PEG4-Eribulin	Eribulin	Microtubule (MT)	Mal-PEG4	[2]
ADC Info	MSLN-Suc/SPAAC-PEG4-Val-Cit-PABC-Eribulin	Eribulin	Microtubule (MT)	Succinamide-SPAAC-PEG4-Val-Cit-PABC	[2]
ADC Info	MSLN-Suc/SPAAC-PEG3-Dis-dim-PABC-Eribulin	Eribulin	Microtubule (MT)	Succinamide-SPAAC-PEG3-Disylfidyl-dimethyl-PABC	[2]
ADC Info	MSLN-Suc/SPAAC-PEG3-Sulfonamide-Eribulin	Eribulin	Microtubule (MT)	Succinamide-SPAAC-PEG3-Sulfonamide	[2]
ADC Info	MSLN-Suc/SPAAC-PEG2-Eribulin	Eribulin	Microtubule (MT)	Succinamide-SPAAC-PEG2	[2]
ADC Info	MSLN-Suc/SPAAC-PEG4-Eribulin	Eribulin	Microtubule (MT)	Succinamide-SPAAC-PEG4	[2]
ADC Info	MSLN-Mal-PEG-Val-Cit-PABC-Cryptophycin	Cryptophycin	Microtubule (MT)	Mal-PEG-Val-Cit-PABC	[2]
ADC Info	MSLN-Mal-Caproyl-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Maleimide-Caproyl-Val-Cit-PABC	[2]
ADC Info	MSLN-Mal-Caproyl-Val-Cit-PABC-MMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimide-Caproyl-Val-Cit-PABC	[2]
ADC Info	Amatuximab-Compound 9	Mertansine DM1	Microtubule (MT)	Amatuximab-Compound 9 linker	[3]
ADC Info	Amatuximab-Compound 17	Mertansine DM4	Microtubule (MT)	Amatuximab-Compound 17 linker	[3]
ADC Info	Amatuximab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 25 linker	[3]
ADC Info	Amatuximab-Compound 31	Auristatin 0101	Microtubule (MT)	Amatuximab-Compound 31 linker	[3]
ADC Info	Amatuximab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 36 linker	[3]
ADC Info	Amatuximab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Amatuximab-Compound 43 linker	[3]
ADC Info	Amatuximab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Amatuximab-Compound 49 linker	[3]
ADC Info	Amatuximab-Compound 55	Mertansine DM1	Microtubule (MT)	Amatuximab-Compound 55 linker	[3]
ADC Info	Amatuximab-Compound 59	Mertansine DM4	Microtubule (MT)	Amatuximab-Compound 59 linker	[3]
ADC Info	Amatuximab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 64 linker	[3]
ADC Info	Amatuximab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 69 linker	[3]
ADC Info	Amatuximab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Amatuximab-Compound 74 linker	[3]
ADC Info	Amatuximab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 75 linker	[3]
ADC Info	Amatuximab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Amatuximab-Compound 76 linker	[3]
ADC Info	Amatuximab-Compound 77	Mertansine DM1	Microtubule (MT)	Amatuximab-Compound 77 linker	[3]
ADC Info	Amatuximab-Compound 78	Auristatin 0101	Microtubule (MT)	Amatuximab-Compound 78 linker	[3]
ADC Info	Amatuximab-Compound 79	Auristatin 0101	Microtubule (MT)	Amatuximab-Compound 79 linker	[3]
ADC Info	Amatuximab-Compound 80	Mertansine DM4	Microtubule (MT)	Amatuximab-Compound 80 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anetumab ravtansine	Mertansine DM4	Microtubule (MT)	N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)	[4]
ADC Info	Anetumab corixetan	Undisclosed	Undisclosed	Undisclosed	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RG7787	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ALA12-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CHS5-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CHS7-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CHS8-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SS1-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RC88-PY-MAA-Val-Cit-PAB-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	RC88-PY-MAA-Val-Cit-PAB-MMAD	Monomethyl auristatin D	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	RC88-Mc-Val-Cit-PAB-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	RC88-Mc-Val-Cit-PAB-MMAD	Monomethyl auristatin D	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	Anti-MSLN-45 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Cit-PABC	[9]
ADC Info	Anti-MSLN-46 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	PEG2-Val-Cit-PABC	[9]
ADC Info	Anti-MSLN-47 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	PEG4-Val-Cit-PABC	[9]
ADC Info	Anti-MSLN-48 ADC	Tetrahydroisoquinoline-based PBD dimer 17	Human Deoxyribonucleic acid (hDNA)	PEG8-Val-Cit-PABC	[9]
ADC Info	Anti-MSLN-44 ADC	Tetrahydroisoquinoline-based PBD dimer 14	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Cit-PABC	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-MSLN mAb 6A4-IIIa-01	Anti-MSLN mAb 6A4-IIIa-01 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-01 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-02	Anti-MSLN mAb 6A4-IIIa-02 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-02 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-03	Anti-MSLN mAb 6A4-IIIa-03 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-03 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-04	Anti-MSLN mAb 6A4-IIIa-04 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-04 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-05	Anti-MSLN mAb 6A4-IIIa-05 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-05 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-06	Anti-MSLN mAb 6A4-IIIa-06 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-06 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-07	Anti-MSLN mAb 6A4-IIIa-07 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-07 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIa-08	Anti-MSLN mAb 6A4-IIIa-08 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIa-08 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-01	Anti-MSLN mAb 6A4-IIIb-01 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-01 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-02	Anti-MSLN mAb 6A4-IIIb-02 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-02 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-03	Anti-MSLN mAb 6A4-IIIb-03 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-03 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-04	Anti-MSLN mAb 6A4-IIIb-04 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-04 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-05	Anti-MSLN mAb 6A4-IIIb-05 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-05 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-06	Anti-MSLN mAb 6A4-IIIb-06 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-06 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-07	Anti-MSLN mAb 6A4-IIIb-07 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-07 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-08	Anti-MSLN mAb 6A4-IIIb-08 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-08 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIb-09	Anti-MSLN mAb 6A4-IIIb-09 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIb-09 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-01	Anti-MSLN mAb 6A4-IIIc-01 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-01 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-02	Anti-MSLN mAb 6A4-IIIc-02 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-02 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-03	Anti-MSLN mAb 6A4-IIIc-03 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-03 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-04	Anti-MSLN mAb 6A4-IIIc-04 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-04 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-05	Anti-MSLN mAb 6A4-IIIc-05 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-05 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-06	Anti-MSLN mAb 6A4-IIIc-06 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-06 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-07	Anti-MSLN mAb 6A4-IIIc-07 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-07 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-IIIc-08	Anti-MSLN mAb 6A4-IIIc-08 payload	Undisclosed	Anti-MSLN mAb 6A4-IIIc-08 linker	[10]
ADC Info	Anti-MSLN mAb 6A4-A	Anti-MSLN mAb 6A4-A payload	Undisclosed	Anti-MSLN mAb 6A4 linker	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LMB-100	Pseudomonas exotoxin LO10R456A	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[11]
ADC Info	LMB-12	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[11]
ADC Info	LMB-164	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	BMS-986148	Tubulysin	Microtubule (MT)	Mal-EBE-Mal	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RG-7600	Monomethyl auristatin E	Microtubule (MT)	Protease-labile valine-citrulline linker	[13]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RC-88	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[14]
ADC Info	HBM9033	Undisclosed	Undisclosed	Undisclosed	[15]
ADC Info	Anti-mesothelin antibody-drug conjugate (Bristol Myers Squibb)	Undisclosed	Undisclosed	Undisclosed	[16]
ADC Info	MSLN ADC (Development Center for Biotechnology)	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[17]
ADC Info	MSLN MMAE	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[18]
ADC Info	NAV-001	Undisclosed	Undisclosed	Undisclosed	[19]
ADC Info	LCB14-17nn	Undisclosed	Undisclosed	Undisclosed	[20]
ADC Info	Immunoconjugate (Bayer AG)	Undisclosed	Undisclosed	Undisclosed	[21]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.028791747; Fold-change: 0.137609449; Z-score: 0.468098562
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.253486974; Fold-change: -0.278509499; Z-score: -2.639844984
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.45E-11; Fold-change: -0.997746164; Z-score: -6.480465887
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.568055386; Fold-change: -0.077386828; Z-score: -0.29408118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.39E-11; Fold-change: -0.183965444; Z-score: -0.740215905
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.78E-05; Fold-change: 0.155482803; Z-score: 1.057877693
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031530062; Fold-change: 0.10058837; Z-score: 0.611572362
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.361411125; Fold-change: 0.08405356; Z-score: 0.39615733
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.060861092; Fold-change: -0.397621123; Z-score: -1.606712428
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.184624787; Fold-change: 0.125464387; Z-score: 0.884019347
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000265201; Fold-change: 2.07020139; Z-score: 9.519314426
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.72E-07; Fold-change: 2.197423049; Z-score: 2.181182738
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.65E-58; Fold-change: 0.745180594; Z-score: 1.311687493
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.05E-51; Fold-change: 0.718030452; Z-score: 1.316576668
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.86E-20; Fold-change: 3.97890685; Z-score: 6.120864756
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.78E-36; Fold-change: 3.162585573; Z-score: 4.125456732
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.605118057; Fold-change: -0.202510155; Z-score: -0.666597206
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.024483322; Fold-change: 0.011764448; Z-score: 0.044658738
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.164537402; Fold-change: 0.016814715; Z-score: 0.109329282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.48E-29; Fold-change: -1.697558326; Z-score: -1.376934975
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.37E-22; Fold-change: -1.946326424; Z-score: -1.565440602
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002700919; Fold-change: -0.554833188; Z-score: -0.95895814
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.088480623; Fold-change: -0.085809746; Z-score: -0.327206225
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.036301808; Fold-change: 0.120794782; Z-score: 0.656558082
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.13E-22; Fold-change: 0.073109659; Z-score: 0.16710702
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.75E-14; Fold-change: 0.058703642; Z-score: 0.19212618
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013548348; Fold-change: 5.443607931; Z-score: 1.915568501
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.018770436; Fold-change: 2.102347412; Z-score: 0.841257334
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.220110551; Fold-change: 1.393902181; Z-score: 0.623502276
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.26715813; Fold-change: -0.353642985; Z-score: -0.242373675
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.35E-07; Fold-change: 0.768370784; Z-score: 2.763706836
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.507206577; Fold-change: 0.170131292; Z-score: 0.227543567
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000145816; Fold-change: 0.160014184; Z-score: 0.838968259
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.514741921; Fold-change: -0.046095382; Z-score: -0.254131984
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003517292; Fold-change: 0.024734579; Z-score: 0.136833138
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.018954495; Fold-change: 0.058674238; Z-score: 0.276828341
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.290165106; Fold-change: -0.10775474; Z-score: -0.547917444
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.62E-15; Fold-change: -2.414171723; Z-score: -1.098492184
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.560621316; Fold-change: -0.13083818; Z-score: -0.669670627
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.96456975; Fold-change: -0.077464853; Z-score: -0.297087373
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.27532534; Fold-change: 0.265292493; Z-score: 0.780055102
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.298563364; Fold-change: -0.022694835; Z-score: -0.066567709
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040294787; Fold-change: -0.236144868; Z-score: -1.830617537
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.55917858; Fold-change: -0.029365838; Z-score: -0.130608906
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.918068319; Fold-change: -0.04469937; Z-score: -0.343927434
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.467449613; Fold-change: -0.104378177; Z-score: -0.551079956
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.117568268; Fold-change: 0.316706507; Z-score: 0.934427897
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.613438353; Fold-change: 0.243515582; Z-score: 3.251366033
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.655526801; Fold-change: 0.069714557; Z-score: 0.275649336
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.505247889; Fold-change: -0.079783632; Z-score: -0.690500104
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.094336587; Fold-change: 0.068617695; Z-score: 0.356317114
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.47939932; Fold-change: 0.047120672; Z-score: 0.275992784
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.585763912; Fold-change: -0.029136193; Z-score: -0.13820537
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.319027272; Fold-change: -0.011612671; Z-score: -0.047463985
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.214983863; Fold-change: -0.062086515; Z-score: -0.245339078
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.676199148; Fold-change: -0.013871187; Z-score: -0.096139742
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.783280908; Fold-change: 0.010880365; Z-score: 0.068089911
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.047374834; Fold-change: 0.104891162; Z-score: 0.33810991
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.649511487; Fold-change: -0.108773107; Z-score: -0.375852568
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.603180611; Fold-change: 0.054025384; Z-score: 0.175864811
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.584961139; Fold-change: 0.046546553; Z-score: 0.245142768
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.176859871; Fold-change: 0.073464705; Z-score: 0.448752615
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.380492677; Fold-change: 0.019962981; Z-score: 0.174932536
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.278619097; Fold-change: 0.830953345; Z-score: 5.321845094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.147128656; Fold-change: 0.041379305; Z-score: 0.406026168
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.965788338; Fold-change: -0.260780923; Z-score: -0.182204862
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.091052947; Fold-change: -0.433029234; Z-score: -0.333605282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.990735514; Fold-change: 0.286578141; Z-score: 0.215509214
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.137035517; Fold-change: 0.185783188; Z-score: 0.132394904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.635900973; Fold-change: -0.143318263; Z-score: -0.237727936
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003107136; Fold-change: 1.676241486; Z-score: 2.703852349
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.048553793; Fold-change: 0.110263309; Z-score: 0.404921769
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.454322832; Fold-change: -0.013261356; Z-score: -0.118656796
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.18614918; Fold-change: -0.105774339; Z-score: -0.271947492
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.305823353; Fold-change: 0.191196643; Z-score: 0.596807587
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.410532846; Fold-change: 0.025060293; Z-score: 0.07054369
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.71E-05; Fold-change: 0.175221004; Z-score: 1.268113691
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.196374003; Fold-change: -0.003850252; Z-score: -0.0094188
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.59E-05; Fold-change: -0.151675304; Z-score: -0.448426118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.860036326; Fold-change: 0.02315172; Z-score: 0.095139616
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.912487479; Fold-change: 0.014103226; Z-score: 0.059648153
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.913634937; Fold-change: 0.024342822; Z-score: 0.157811159
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.749253139; Fold-change: -0.200350163; Z-score: -0.395088622
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.446436085; Fold-change: -0.002701082; Z-score: -0.021767533
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.38E-05; Fold-change: 0.079271089; Z-score: 0.319655527
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.108776; Fold-change: -0.338163994; Z-score: -1.282439225
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.838603737; Fold-change: -0.001925132; Z-score: -0.015415255
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.628025469; Fold-change: 0.153831424; Z-score: 0.428651689
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.062634408; Fold-change: 0.184347412; Z-score: 0.292205397
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.222952356; Fold-change: 0.05325689; Z-score: 0.881447821
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.7372469; Fold-change: 0.143868749; Z-score: 0.099091107
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.52E-09; Fold-change: 0.132726945; Z-score: 0.59304189
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004431988; Fold-change: -0.391569247; Z-score: -1.310241772
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128624415; Fold-change: -0.118632599; Z-score: -0.554655577
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.309380496; Fold-change: 0.006242078; Z-score: 0.010065549
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.53E-12; Fold-change: 0.336370784; Z-score: 1.047380083
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.255151027; Fold-change: -0.181165053; Z-score: -0.316546046
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000949688; Fold-change: 0.416914156; Z-score: 1.001155526
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.88E-05; Fold-change: 0.601401835; Z-score: 1.982361683
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.63E-10; Fold-change: -0.310189191; Z-score: -0.707671231
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.52E-12; Fold-change: -0.34205169; Z-score: -0.839058923
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.034707552; Fold-change: -0.126523737; Z-score: -0.315635257
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.065149175; Fold-change: -0.146396741; Z-score: -0.23880053
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.978924572; Fold-change: -0.055702624; Z-score: -0.213040725
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.619475009; Fold-change: -0.106855456; Z-score: -0.775748627
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.515913762; Fold-change: -0.026626251; Z-score: -0.221043017
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.240059153; Fold-change: -0.090717835; Z-score: -0.410846491
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.481679843; Fold-change: 0.110643829; Z-score: 0.429755239
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000182263; Fold-change: 0.13704235; Z-score: 0.880654144
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.879212721; Fold-change: -0.121629601; Z-score: -0.717297757
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.66073022; Fold-change: -0.131941889; Z-score: -0.110396051
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.062879566; Fold-change: -3.749512853; Z-score: -1.722822802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.062114; Fold-change: 0.096950731; Z-score: 1.015889268
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.999225203; Fold-change: 0.03692002; Z-score: 0.213341499
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.731786188; Fold-change: 0.029136621; Z-score: 0.205505189
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.334153589; Fold-change: 0.061882464; Z-score: 0.236513104
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.266199961; Fold-change: -0.037600986; Z-score: -0.182389964
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.292300891; Fold-change: 0.001524674; Z-score: 0.014009575
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.712486366; Fold-change: -0.011123979; Z-score: -0.076843548
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.949263894; Fold-change: 0.040032546; Z-score: 0.152870562
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.189176975; Fold-change: 0.039092829; Z-score: 0.114930722
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.543524833; Fold-change: 0.008445879; Z-score: 0.050232166
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048701734; Fold-change: 0.249532734; Z-score: 1.344682573
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.663149939; Fold-change: -0.005982565; Z-score: -0.031019523
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.845834994; Fold-change: 0.045517429; Z-score: 0.26726406
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.320461741; Fold-change: -0.039026508; Z-score: -0.363586987
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.415240606; Fold-change: 0.010761097; Z-score: 0.111639232
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002577916; Fold-change: -0.276488762; Z-score: -1.145909533
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.208695316; Fold-change: -0.065774401; Z-score: -0.416859137
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Preclinical Efficacy of an Antibody-Drug Conjugate Targeting Mesothelin Correlates with Quantitative 89Zr-ImmunoPET. Mol Cancer Ther. 2017 Jan;16(1):134-142. doi: 10.1158/1535-7163.MCT-16-0449. Epub 2016 Oct 19.
Ref 2	MORAb-202, an Antibody-Drug Conjugate Utilizing Humanized Anti-human FR Farletuzumab and the Microtubule-targeting Agent Eribulin, has Potent Antitumor Activity. Mol Cancer Ther. 2018 Dec;17(12):2665-2675. doi: 10.1158/1535-7163.MCT-17-1215. Epub 2018 Sep 27.
Ref 3	Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 4	Anetumab ravtansine versus vinorelbine in patients with relapsed, mesothelin-positive malignant pleural mesothelioma (ARCS-M): a randomised, open-label phase 2 trial. Lancet Oncol. 2022 Apr;23(4):540-552.
Ref 5	ADC review: basic information about Anetumab corixetan.
Ref 6	Anticancer Effects of Mesothelin-Targeted Immunotoxin Therapy Are Regulated by Tyrosine Kinase DDR1. Cancer Res. 2016 Mar 15;76(6):1560-8. doi: 10.1158/0008-5472.CAN-15-2401. Epub 2015 Dec 30.
Ref 7	Eradicating mesothelin-positive human gastric and pancreatic tumors in xenograft models with optimized anti-mesothelin antibody-drug conjugates from synthetic antibody libraries. Sci Rep. 2021 Jul 29;11(1):15430. doi: 10.1038/s41598-021-94902-1.
Ref 8	Anti-mesothelin antibody and antibody-drug conjugate thereof; 2019-11-28.
Ref 9	Design, Synthesis, and Structure-Activity Relationships of Novel Tetrahydroisoquinolino Benzodiazepine Dimer Antitumor Agents and Their Application in Antibody-Drug Conjugates. J Med Chem. 2020 Nov 25;63(22):13913-13950. doi: 10.1021/acs.jmedchem.0c01385.
Ref 10	Benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 11	Anti-Mesothelin Recombinant Immunotoxin Therapy for Colorectal Cancer. Clin Colorectal Cancer. 2019 Sep;18(3):192-199.e1. doi: 10.1016/j.clcc.2019.06.006. Epub 2019 Jul 2.
Ref 12	Phase I/IIa Trial of BMS-986148, an Anti-mesothelin Antibody-drug Conjugate, Alone or in Combination with Nivolumab in Patients with Advanced Solid Tumors. Clin Cancer Res. 2022 Jan 1;28(1):95-105.
Ref 13	Phase I Study of DMOT4039A, an Antibody-Drug Conjugate Targeting Mesothelin, in Patients with Unresectable Pancreatic or Platinum-Resistant Ovarian Cancer. Mol Cancer Ther. 2016 Mar;15(3):439-47. doi: 10.1158/1535-7163.MCT-15-0693.
Ref 14	Preclinical safety profile of RC88-ADCa novel mesothelin-targeted antibody conjugated with Monomethyl auristatin E. Drug Chem Toxicol. 2023 Jan;46(1):24-34. doi: 10.1080/01480545.2021.2005085. Epub 2021 Nov 28.
Ref 15	Harbour biomed biopharmaceutical company product pipeline
Ref 16	Introduction to basic information on anti-mesothelin antibody-drug conjugate(Bristol Myers Squibb).
Ref 17	Anti-MSLN ADC against cancer; institute of pharmaceutics development center for biotechnology; 2020
Ref 18	A clinical candidate anti-mesothelin-MMAE antibody-drug conjugate (ADC) for therapy of mesothelin-expressing cancers. Cancer Res (2014) 74 (19_Supplement): 4494.
Ref 19	NAV-001, a high-efficacy antibody-drug conjugate targeting mesothelin with improved delivery of a potent payload by counteracting MUC16/CA125 inhibitory effects. PLoS One. 2023 May 17;18(5):e0285161. doi: 10.1371/journal.pone.0285161.
Ref 20	ADC review: basic information about LCB14-17NN.
Ref 21	Introduction to basic information on ADC drug Immunoconjugate (Bayer AG)