General Information of This Antigen
Antigen ID
TAR0NEZUA
Antigen Name
Mesothelin (MSLN)
Gene Name
MSLN
Gene ID
10232
Synonym
MPF; CAK1 antigen;Pre-pro-megakaryocyte-potentiating factor
Sequence
MALP.PLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLS
PRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDL
LLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADV
RALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSV
STMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTAC
PSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQ
GYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVATL
IDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLD
VLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPL
TVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQ
EALSGTPCLLGPGPVLTVLALLLASTLA

    Click to Show/Hide
Family
LAMP family
Function
Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) potentiates megakaryocyte colony formation in vitro.

    Click to Show/Hide
Uniprot Entry
MSLN_HUMAN
HGNC ID
HGNC:7371
KEGG ID
hsa:10232
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Amatuximab
ADC Info ADC Name Payload Target Linker Ref
Amatuximab-Compound 17
Mertansine DM4
Microtubule (MT)
Amatuximab-Compound 17 linker
[1]
Amatuximab-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 25 linker
[1]
Amatuximab-Compound 31
Auristatin 0101
Microtubule (MT)
Amatuximab-Compound 31 linker
[1]
Amatuximab-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 36 linker
[1]
Amatuximab-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Amatuximab-Compound 43 linker
[1]
Amatuximab-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Amatuximab-Compound 49 linker
[1]
Amatuximab-Compound 55
Mertansine DM1
Microtubule (MT)
Amatuximab-Compound 55 linker
[1]
Amatuximab-Compound 59
Mertansine DM4
Microtubule (MT)
Amatuximab-Compound 59 linker
[1]
Amatuximab-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 64 linker
[1]
Amatuximab-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 69 linker
[1]
Amatuximab-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Amatuximab-Compound 74 linker
[1]
Amatuximab-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 75 linker
[1]
Amatuximab-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Amatuximab-Compound 76 linker
[1]
Amatuximab-Compound 77
Mertansine DM1
Microtubule (MT)
Amatuximab-Compound 77 linker
[1]
Amatuximab-Compound 78
Auristatin 0101
Microtubule (MT)
Amatuximab-Compound 78 linker
[1]
Amatuximab-Compound 79
Auristatin 0101
Microtubule (MT)
Amatuximab-Compound 79 linker
[1]
Amatuximab-Compound 80
Mertansine DM4
Microtubule (MT)
Amatuximab-Compound 80 linker
[1]
Amatuximab-Compound 9
Mertansine DM1
Microtubule (MT)
Amatuximab-Compound 9 linker
[1]
MSLN-Mal-Caproyl-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[2]
MSLN-Mal-Caproyl-Val-Cit-PABC-MMAE
Monomethyl auristatin E
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[2]
MSLN-Mal-Caproyl-Val-Cit-PABC-MMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimide-Caproyl-Val-Cit-PABC
[2]
MSLN-Mal-PEG2-Ala-Ala-Asn-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2-Ala-Ala-Asn-PABC
[2]
MSLN-Mal-PEG2-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2
[2]
MSLN-Mal-PEG2-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG2-Val-Cit-PABC
[2]
MSLN-Mal-PEG4-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4
[2]
MSLN-Mal-PEG4-tria-PEG3-Dis-dim-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4-triazole-PEG3-Disulfidyl-dimethyl-PABC
[2]
MSLN-Mal-PEG4-tria-PEG3-Sulfo-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG4-triazole-PEG3-Sulfonamide
[2]
MSLN-Mal-PEG8-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Mal-PEG8-Val-Cit-PABC
[2]
MSLN-Mal-PEG-Val-Cit-PABC-Cryptophycin
Cryptophycin
Microtubule (MT)
Mal-PEG-Val-Cit-PABC
[2]
MSLN-Suc/SPAAC-PEG2-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG2
[2]
MSLN-Suc/SPAAC-PEG3-Dis-dim-PABC-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG3-Disylfidyl-dimethyl-PABC
[2]
MSLN-Suc/SPAAC-PEG3-Sulfonamide-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG3-Sulfonamide
[2]
MSLN-Suc/SPAAC-PEG4-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG4
[2]
MSLN-Suc/SPAAC-PEG4-Val-Cit-PABC-Eribulin
Eribulin
Microtubule (MT)
Succinamide-SPAAC-PEG4-Val-Cit-PABC
[2]
ADC Info ADC Name Payload Target Linker Ref
Anetumab ravtansine
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[3]
Anetumab corixetan
Undisclosed
Undisclosed
Undisclosed
[4]
Anti-MSLN Anti-ody Fab fragment
ADC Info ADC Name Payload Target Linker Ref
RG7787
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[5]
Anti-MSLN IgG1-ALA12
ADC Info ADC Name Payload Target Linker Ref
ALA12-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Anti-MSLN IgG1-CHS5
ADC Info ADC Name Payload Target Linker Ref
CHS5-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Anti-MSLN IgG1-CHS7
ADC Info ADC Name Payload Target Linker Ref
CHS7-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Anti-MSLN IgG1-CHS8
ADC Info ADC Name Payload Target Linker Ref
CHS8-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Anti-MSLN IgG1-SS1
ADC Info ADC Name Payload Target Linker Ref
SS1-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Anti-MSLN mAb
ADC Info ADC Name Payload Target Linker Ref
Anti-MSLN-44 ADC
Tetrahydroisoquinoline-based PBD dimer 14
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Cit-PABC
[7]
Anti-MSLN-45 ADC
Tetrahydroisoquinoline-based PBD dimer 17
Human Deoxyribonucleic acid (hDNA)
Mc-Val-Cit-PABC
[7]
Anti-MSLN-46 ADC
Tetrahydroisoquinoline-based PBD dimer 17
Human Deoxyribonucleic acid (hDNA)
PEG2-Val-Cit-PABC
[7]
Anti-MSLN-47 ADC
Tetrahydroisoquinoline-based PBD dimer 17
Human Deoxyribonucleic acid (hDNA)
PEG4-Val-Cit-PABC
[7]
Anti-MSLN-48 ADC
Tetrahydroisoquinoline-based PBD dimer 17
Human Deoxyribonucleic acid (hDNA)
PEG8-Val-Cit-PABC
[7]
RC88-Mc-Val-Cit-PAB-MMAD
Monomethyl auristatin D
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
RC88-Mc-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
RC88-PY-MAA-Val-Cit-PAB-MMAD
Monomethyl auristatin D
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
RC88-PY-MAA-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
Anti-MSLN mAb 6A4
ADC Info ADC Name Payload Target Linker Ref
Anti-MSLN mAb 6A4-A
Anti-MSLN mAb 6A4-A payload
Undisclosed
Anti-MSLN mAb 6A4 linker
[9]
Anti-MSLN mAb 6A4-IIIa-01
Anti-MSLN mAb 6A4-IIIa-01 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-01 linker
[9]
Anti-MSLN mAb 6A4-IIIa-02
Anti-MSLN mAb 6A4-IIIa-02 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-02 linker
[9]
Anti-MSLN mAb 6A4-IIIa-03
Anti-MSLN mAb 6A4-IIIa-03 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-03 linker
[9]
Anti-MSLN mAb 6A4-IIIa-04
Anti-MSLN mAb 6A4-IIIa-04 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-04 linker
[9]
Anti-MSLN mAb 6A4-IIIa-05
Anti-MSLN mAb 6A4-IIIa-05 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-05 linker
[9]
Anti-MSLN mAb 6A4-IIIa-06
Anti-MSLN mAb 6A4-IIIa-06 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-06 linker
[9]
Anti-MSLN mAb 6A4-IIIa-07
Anti-MSLN mAb 6A4-IIIa-07 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-07 linker
[9]
Anti-MSLN mAb 6A4-IIIa-08
Anti-MSLN mAb 6A4-IIIa-08 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIa-08 linker
[9]
Anti-MSLN mAb 6A4-IIIb-01
Anti-MSLN mAb 6A4-IIIb-01 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-01 linker
[9]
Anti-MSLN mAb 6A4-IIIb-02
Anti-MSLN mAb 6A4-IIIb-02 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-02 linker
[9]
Anti-MSLN mAb 6A4-IIIb-03
Anti-MSLN mAb 6A4-IIIb-03 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-03 linker
[9]
Anti-MSLN mAb 6A4-IIIb-04
Anti-MSLN mAb 6A4-IIIb-04 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-04 linker
[9]
Anti-MSLN mAb 6A4-IIIb-05
Anti-MSLN mAb 6A4-IIIb-05 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-05 linker
[9]
Anti-MSLN mAb 6A4-IIIb-06
Anti-MSLN mAb 6A4-IIIb-06 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-06 linker
[9]
Anti-MSLN mAb 6A4-IIIb-07
Anti-MSLN mAb 6A4-IIIb-07 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-07 linker
[9]
Anti-MSLN mAb 6A4-IIIb-08
Anti-MSLN mAb 6A4-IIIb-08 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-08 linker
[9]
Anti-MSLN mAb 6A4-IIIb-09
Anti-MSLN mAb 6A4-IIIb-09 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIb-09 linker
[9]
Anti-MSLN mAb 6A4-IIIc-01
Anti-MSLN mAb 6A4-IIIc-01 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-01 linker
[9]
Anti-MSLN mAb 6A4-IIIc-02
Anti-MSLN mAb 6A4-IIIc-02 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-02 linker
[9]
Anti-MSLN mAb 6A4-IIIc-03
Anti-MSLN mAb 6A4-IIIc-03 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-03 linker
[9]
Anti-MSLN mAb 6A4-IIIc-04
Anti-MSLN mAb 6A4-IIIc-04 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-04 linker
[9]
Anti-MSLN mAb 6A4-IIIc-05
Anti-MSLN mAb 6A4-IIIc-05 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-05 linker
[9]
Anti-MSLN mAb 6A4-IIIc-06
Anti-MSLN mAb 6A4-IIIc-06 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-06 linker
[9]
Anti-MSLN mAb 6A4-IIIc-07
Anti-MSLN mAb 6A4-IIIc-07 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-07 linker
[9]
Anti-MSLN mAb 6A4-IIIc-08
Anti-MSLN mAb 6A4-IIIc-08 payload
Undisclosed
Anti-MSLN mAb 6A4-IIIc-08 linker
[9]
Anti-MSLN scFv
ADC Info ADC Name Payload Target Linker Ref
LMB-100
Pseudomonas exotoxin LO10R456A
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[10]
LMB-12
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[10]
LMB-164
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[10]
BMS-986021
ADC Info ADC Name Payload Target Linker Ref
BMS-986148
Tubulysin
Microtubule (MT)
Mc-Val-Cit
[11]
Humanized IgG1 Anti-MSLN mAb h7D9.v3
ADC Info ADC Name Payload Target Linker Ref
DMOT4039A
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[12]
Misitatug
ADC Info ADC Name Payload Target Linker Ref
RC-88
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[13]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
HBM9033
Undisclosed
DNA topoisomerase 1 (TOP1)
Undisclosed
[14]
Immunoconjugate (Bayer AG)
Undisclosed
Unclear
Undisclosed
[15]
Anti-mesothelin antibody-drug conjugate (Bristol Myers Squibb)
Undisclosed
Undisclosed
Undisclosed
[16]
LCB14-17nn
Undisclosed
Undisclosed
Undisclosed
[17]
MSLN ADC (Development Center for Biotechnology)
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[18]
MSLN MMAE
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[19]
NAV-001
Undisclosed
Undisclosed
Undisclosed
[20]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028791747; Fold-change: 0.137609449; Z-score: 0.468098562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.253486974; Fold-change: -0.278509499; Z-score: -2.639844984
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.45E-11; Fold-change: -0.997746164; Z-score: -6.480465887
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.568055386; Fold-change: -0.077386828; Z-score: -0.29408118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.39E-11; Fold-change: -0.183965444; Z-score: -0.740215905
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.78E-05; Fold-change: 0.155482803; Z-score: 1.057877693
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031530062; Fold-change: 0.10058837; Z-score: 0.611572362
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.361411125; Fold-change: 0.08405356; Z-score: 0.39615733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.060861092; Fold-change: -0.397621123; Z-score: -1.606712428
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.184624787; Fold-change: 0.125464387; Z-score: 0.884019347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000265201; Fold-change: 2.07020139; Z-score: 9.519314426
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.72E-07; Fold-change: 2.197423049; Z-score: 2.181182738
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.65E-58; Fold-change: 0.745180594; Z-score: 1.311687493
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.05E-51; Fold-change: 0.718030452; Z-score: 1.316576668
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.86E-20; Fold-change: 3.97890685; Z-score: 6.120864756
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.78E-36; Fold-change: 3.162585573; Z-score: 4.125456732
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.605118057; Fold-change: -0.202510155; Z-score: -0.666597206
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.024483322; Fold-change: 0.011764448; Z-score: 0.044658738
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.164537402; Fold-change: 0.016814715; Z-score: 0.109329282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.48E-29; Fold-change: -1.697558326; Z-score: -1.376934975
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.37E-22; Fold-change: -1.946326424; Z-score: -1.565440602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002700919; Fold-change: -0.554833188; Z-score: -0.95895814
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.088480623; Fold-change: -0.085809746; Z-score: -0.327206225
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.036301808; Fold-change: 0.120794782; Z-score: 0.656558082
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.13E-22; Fold-change: 0.073109659; Z-score: 0.16710702
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.75E-14; Fold-change: 0.058703642; Z-score: 0.19212618
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013548348; Fold-change: 5.443607931; Z-score: 1.915568501
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.018770436; Fold-change: 2.102347412; Z-score: 0.841257334
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.220110551; Fold-change: 1.393902181; Z-score: 0.623502276
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.26715813; Fold-change: -0.353642985; Z-score: -0.242373675
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.35E-07; Fold-change: 0.768370784; Z-score: 2.763706836
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.507206577; Fold-change: 0.170131292; Z-score: 0.227543567
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000145816; Fold-change: 0.160014184; Z-score: 0.838968259
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.514741921; Fold-change: -0.046095382; Z-score: -0.254131984
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003517292; Fold-change: 0.024734579; Z-score: 0.136833138
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.018954495; Fold-change: 0.058674238; Z-score: 0.276828341
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.290165106; Fold-change: -0.10775474; Z-score: -0.547917444
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.62E-15; Fold-change: -2.414171723; Z-score: -1.098492184
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.560621316; Fold-change: -0.13083818; Z-score: -0.669670627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.96456975; Fold-change: -0.077464853; Z-score: -0.297087373
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.27532534; Fold-change: 0.265292493; Z-score: 0.780055102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.298563364; Fold-change: -0.022694835; Z-score: -0.066567709
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040294787; Fold-change: -0.236144868; Z-score: -1.830617537
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.55917858; Fold-change: -0.029365838; Z-score: -0.130608906
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.918068319; Fold-change: -0.04469937; Z-score: -0.343927434
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.467449613; Fold-change: -0.104378177; Z-score: -0.551079956
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.117568268; Fold-change: 0.316706507; Z-score: 0.934427897
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.613438353; Fold-change: 0.243515582; Z-score: 3.251366033
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.655526801; Fold-change: 0.069714557; Z-score: 0.275649336
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.505247889; Fold-change: -0.079783632; Z-score: -0.690500104
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.094336587; Fold-change: 0.068617695; Z-score: 0.356317114
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.47939932; Fold-change: 0.047120672; Z-score: 0.275992784
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.585763912; Fold-change: -0.029136193; Z-score: -0.13820537
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.319027272; Fold-change: -0.011612671; Z-score: -0.047463985
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.214983863; Fold-change: -0.062086515; Z-score: -0.245339078
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.676199148; Fold-change: -0.013871187; Z-score: -0.096139742
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.783280908; Fold-change: 0.010880365; Z-score: 0.068089911
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.047374834; Fold-change: 0.104891162; Z-score: 0.33810991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.649511487; Fold-change: -0.108773107; Z-score: -0.375852568
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.603180611; Fold-change: 0.054025384; Z-score: 0.175864811
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.584961139; Fold-change: 0.046546553; Z-score: 0.245142768
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.176859871; Fold-change: 0.073464705; Z-score: 0.448752615
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.380492677; Fold-change: 0.019962981; Z-score: 0.174932536
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.278619097; Fold-change: 0.830953345; Z-score: 5.321845094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.147128656; Fold-change: 0.041379305; Z-score: 0.406026168
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.965788338; Fold-change: -0.260780923; Z-score: -0.182204862
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.091052947; Fold-change: -0.433029234; Z-score: -0.333605282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.990735514; Fold-change: 0.286578141; Z-score: 0.215509214
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.137035517; Fold-change: 0.185783188; Z-score: 0.132394904
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.635900973; Fold-change: -0.143318263; Z-score: -0.237727936
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003107136; Fold-change: 1.676241486; Z-score: 2.703852349
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.048553793; Fold-change: 0.110263309; Z-score: 0.404921769
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.454322832; Fold-change: -0.013261356; Z-score: -0.118656796
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.18614918; Fold-change: -0.105774339; Z-score: -0.271947492
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.305823353; Fold-change: 0.191196643; Z-score: 0.596807587
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.410532846; Fold-change: 0.025060293; Z-score: 0.07054369
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.71E-05; Fold-change: 0.175221004; Z-score: 1.268113691
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.196374003; Fold-change: -0.003850252; Z-score: -0.0094188
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.59E-05; Fold-change: -0.151675304; Z-score: -0.448426118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.860036326; Fold-change: 0.02315172; Z-score: 0.095139616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.912487479; Fold-change: 0.014103226; Z-score: 0.059648153
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.913634937; Fold-change: 0.024342822; Z-score: 0.157811159
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.749253139; Fold-change: -0.200350163; Z-score: -0.395088622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.446436085; Fold-change: -0.002701082; Z-score: -0.021767533
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.38E-05; Fold-change: 0.079271089; Z-score: 0.319655527
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.108776; Fold-change: -0.338163994; Z-score: -1.282439225
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838603737; Fold-change: -0.001925132; Z-score: -0.015415255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.628025469; Fold-change: 0.153831424; Z-score: 0.428651689
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062634408; Fold-change: 0.184347412; Z-score: 0.292205397
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.222952356; Fold-change: 0.05325689; Z-score: 0.881447821
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.7372469; Fold-change: 0.143868749; Z-score: 0.099091107
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.52E-09; Fold-change: 0.132726945; Z-score: 0.59304189
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004431988; Fold-change: -0.391569247; Z-score: -1.310241772
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.128624415; Fold-change: -0.118632599; Z-score: -0.554655577
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.309380496; Fold-change: 0.006242078; Z-score: 0.010065549
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.53E-12; Fold-change: 0.336370784; Z-score: 1.047380083
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.255151027; Fold-change: -0.181165053; Z-score: -0.316546046
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000949688; Fold-change: 0.416914156; Z-score: 1.001155526
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.88E-05; Fold-change: 0.601401835; Z-score: 1.982361683
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.63E-10; Fold-change: -0.310189191; Z-score: -0.707671231
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.52E-12; Fold-change: -0.34205169; Z-score: -0.839058923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034707552; Fold-change: -0.126523737; Z-score: -0.315635257
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.065149175; Fold-change: -0.146396741; Z-score: -0.23880053
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.978924572; Fold-change: -0.055702624; Z-score: -0.213040725
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.619475009; Fold-change: -0.106855456; Z-score: -0.775748627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.515913762; Fold-change: -0.026626251; Z-score: -0.221043017
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.240059153; Fold-change: -0.090717835; Z-score: -0.410846491
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481679843; Fold-change: 0.110643829; Z-score: 0.429755239
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000182263; Fold-change: 0.13704235; Z-score: 0.880654144
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.879212721; Fold-change: -0.121629601; Z-score: -0.717297757
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.66073022; Fold-change: -0.131941889; Z-score: -0.110396051
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.062879566; Fold-change: -3.749512853; Z-score: -1.722822802
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062114; Fold-change: 0.096950731; Z-score: 1.015889268
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.999225203; Fold-change: 0.03692002; Z-score: 0.213341499
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.731786188; Fold-change: 0.029136621; Z-score: 0.205505189
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.334153589; Fold-change: 0.061882464; Z-score: 0.236513104
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.266199961; Fold-change: -0.037600986; Z-score: -0.182389964
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.292300891; Fold-change: 0.001524674; Z-score: 0.014009575
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.712486366; Fold-change: -0.011123979; Z-score: -0.076843548
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.949263894; Fold-change: 0.040032546; Z-score: 0.152870562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189176975; Fold-change: 0.039092829; Z-score: 0.114930722
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.543524833; Fold-change: 0.008445879; Z-score: 0.050232166
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.048701734; Fold-change: 0.249532734; Z-score: 1.344682573
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.663149939; Fold-change: -0.005982565; Z-score: -0.031019523
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.845834994; Fold-change: 0.045517429; Z-score: 0.26726406
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.320461741; Fold-change: -0.039026508; Z-score: -0.363586987
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.415240606; Fold-change: 0.010761097; Z-score: 0.111639232
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002577916; Fold-change: -0.276488762; Z-score: -1.145909533
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.208695316; Fold-change: -0.065774401; Z-score: -0.416859137
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 2 MORAb-202, an Antibody-Drug Conjugate Utilizing Humanized Anti-human FR Farletuzumab and the Microtubule-targeting Agent Eribulin, has Potent Antitumor Activity. Mol Cancer Ther. 2018 Dec;17(12):2665-2675. doi: 10.1158/1535-7163.MCT-17-1215. Epub 2018 Sep 27.
Ref 3 Anetumab ravtansine versus vinorelbine in patients with relapsed, mesothelin-positive malignant pleural mesothelioma (ARCS-M): a randomised, open-label phase 2 trial. Lancet Oncol. 2022 Apr;23(4):540-552.
Ref 4 ADC review: basic information about Anetumab corixetan.
Ref 5 Anticancer Effects of Mesothelin-Targeted Immunotoxin Therapy Are Regulated by Tyrosine Kinase DDR1. Cancer Res. 2016 Mar 15;76(6):1560-8. doi: 10.1158/0008-5472.CAN-15-2401. Epub 2015 Dec 30.
Ref 6 Eradicating mesothelin-positive human gastric and pancreatic tumors in xenograft models with optimized anti-mesothelin antibody-drug conjugates from synthetic antibody libraries. Sci Rep. 2021 Jul 29;11(1):15430. doi: 10.1038/s41598-021-94902-1.
Ref 7 Design, Synthesis, and Structure-Activity Relationships of Novel Tetrahydroisoquinolino Benzodiazepine Dimer Antitumor Agents and Their Application in Antibody-Drug Conjugates. J Med Chem. 2020 Nov 25;63(22):13913-13950. doi: 10.1021/acs.jmedchem.0c01385.
Ref 8 Anti-mesothelin antibody and antibody-drug conjugate thereof; 2019-11-28.
Ref 9 Benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 10 Anti-Mesothelin Recombinant Immunotoxin Therapy for Colorectal Cancer. Clin Colorectal Cancer. 2019 Sep;18(3):192-199.e1. doi: 10.1016/j.clcc.2019.06.006. Epub 2019 Jul 2.
Ref 11 Phase I/IIa Trial of BMS-986148, an Anti-mesothelin Antibody-drug Conjugate, Alone or in Combination with Nivolumab in Patients with Advanced Solid Tumors. Clin Cancer Res. 2022 Jan 1;28(1):95-105.
Ref 12 Preclinical Efficacy of an Antibody-Drug Conjugate Targeting Mesothelin Correlates with Quantitative 89Zr-ImmunoPET. Mol Cancer Ther. 2017 Jan;16(1):134-142. doi: 10.1158/1535-7163.MCT-16-0449. Epub 2016 Oct 19.
Ref 13 Preclinical safety profile of RC88-ADCa novel mesothelin-targeted antibody conjugated with Monomethyl auristatin E. Drug Chem Toxicol. 2023 Jan;46(1):24-34. doi: 10.1080/01480545.2021.2005085. Epub 2021 Nov 28.
Ref 14 Harbour biomed biopharmaceutical company product pipeline
Ref 15 Introduction to basic information on ADC drug Immunoconjugate (Bayer AG)
Ref 16 Introduction to basic information on anti-mesothelin antibody-drug conjugate(Bristol Myers Squibb).
Ref 17 ADC review: basic information about LCB14-17NN.
Ref 18 Anti-MSLN ADC against cancer; institute of pharmaceutics development center for biotechnology; 2020
Ref 19 A clinical candidate anti-mesothelin-MMAE antibody-drug conjugate (ADC) for therapy of mesothelin-expressing cancers. Cancer Res (2014) 74 (19_Supplement): 4494.
Ref 20 NAV-001, a high-efficacy antibody-drug conjugate targeting mesothelin with improved delivery of a potent payload by counteracting MUC16/CA125 inhibitory effects. PLoS One. 2023 May 17;18(5):e0285161. doi: 10.1371/journal.pone.0285161.