Antibody Information
General Information of This Antibody
| Antibody ID | ANI0RYL004 |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Misitatug |
|||||
| Antigen Name | Mesothelin (MSLN) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTIVY
TPSLKDKFIISRDNAKNTLYLQMNSLRAEDTALYYCARRGSHYYGYRTGYFDVWGAGTTV TVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DVVMTQSPAFLSVTPGEKVTMTCSASSSVSYMYWHQQKPDQAPKLLIYDTSNLASGVPVR
FSGSGSGTDFTFTISRMEAEDAATYYCQQWSSYPPTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
RC-88 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT04175847 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
To evaluate the safety of RC88 for injection in patients with advanced malignant solid tumors, multicenter, open, multi-cohort extension of efficacy and pharmacokinetic characteristics phase 1 /2a clinical study.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Patients with malignant pleural mesothelioma and MSLN in advanced malignant solid tumors.
|
||||
| Administration Dosage |
Dose of 0.10, 0.50, 1.00, 1.50, 2.00 and 2.50 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04175847 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
To evaluate the safety of RC88 for injection in patients with advanced malignant solid tumors, multicenter, open, multi-cohort extension of efficacy and pharmacokinetic characteristics phase 1 /2a clinical study.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05508334 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, non-randomised, multicentre study to allow continued access to and assess the safety and tolerability of RC88 for patients with advanced solid tumours.
|
||||
References