General Information of This Antibody
Antibody ID
ANI0JGMTX
Antibody Name
Anetumab
Organization
Bayer AG
Indication
Solid tumors
Synonyms
MF-T
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-lambda
Antigen Name
Mesothelin (MSLN)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVELVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQAPGKGLEWMGIIDPGDSRTRY
SPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGQLYGGTYMDGWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIALTQPASVSGSPGQSITISCTGTSSDIGGYNSVSWYQQHPGKAPKLMIYGVNNRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCSSYDIESATPVFGGGTKLTVLGQPKAAPSV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKGDSSPVKAGVETTTPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anetumab ravtansine [Phase 2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 26 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients: platinum-resistant/refractory high-grade ovarian/fallopian tube/primary peritoneal cancer (GCIC criteria; measurable disease required for Phase 2); ECOG ≤2; adequate hematologic/organ function; MSLN-positive (≥30% tumor cells with 2+ staining) for Phase 2 only. Key exclusions: recent chemotherapy/radiotherapy (≤4 weeks); strong CYP3A4 modulators; uncontrolled comorbidities (HTN, cardiovascular/CNS events, infections); pregnancy; prior bevacizumab/weekly paclitaxel in platinum-resistant setting. Brain metastases allowed if stable ≥4 weeks post-radiation without steroids.

   Click to Show/Hide
Administration Dosage
Patients receive anetumab ravtansine IV over 1 hour on days 1, 8, 15, and 22 and bevacizumab over 30-90 minutes IV on days 1 and 15. Cycles repeat every 28 days in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT03587311  Clinical Status PHASE2
Clinical Description
A Randomized Phase 2 Study of Bevacizumab and Either Weekly Anetumab Ravtansine or Weekly Paclitaxel in Platinum-Resistant or Platinum Refractory Ovarian Cancer
Primary Endpoint
PFS will be evaluated over 1 year using Kaplan-Meier methodology and compared between groups with a log-rank test, including median, 6-month estimates with 95% CIs, and corresponding survival plots.
Other Endpoint
Tumor response (RECIST) will undergo a single final analysis at 1 year with two-sided testing (alpha=0.05) and 95% CIs for outcome measures.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Inclusion: Unresectable/metastatic pancreatic cancer (1-2 prior chemo lines; 2+/3+ mesothelin expression in ≥30% tumor cells), ECOG 0-1, adequate organ function. Exclusion: Prior mesothelin-targeted therapy, significant cardiac/ocular/CNS conditions, active infections (HIV/HBV/HCV), recent major surgery, unresolved toxicity >Grade 1, or pregnancy. Brain metastases allowed if stable >6 months post-therapy with negative imaging.

   Click to Show/Hide
Administration Dosage
Patients will receive anetumab ravtansine IV infusion at a dose of 6.5 mg/kg (recommended Phase II dose) on Day 1 of a 21-day cycle
Related Clinical Trial
NCT Number NCT03023722  Clinical Status PHASE2
Clinical Description
An Open-label, Phase II Study of Intravenous Anetumab Ravtansine (BAY 94-9343), an Anti-mesothelin Antibody Drug Conjugate, in Pretreated Mesothelin-expressing Advanced Pancreatic Cancer
Primary Endpoint
Response rate will be evaluated per RECIST 1.1 via contrast-enhanced CT/MRI (chest/abdomen/pelvis) with baseline prescreening scans and subsequent assessments every 6 weeks (initial 6 months), then every 9 weeks (year 2), and 12 weeks thereafter until progression/study end (up to 3 years).
Other Endpoint
Time to progression (TTP) measures duration from treatment start to RECIST progression/death, with censoring for other discontinuations. Drug toxicity will be graded per NCI-CTCAE v4.03, capturing all adverse events during the 3-year follow-up.
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Inclusion: Metastatic/unresectable pancreatic adenocarcinoma (mesothelin-positive; ≥5% tumor cells for escalation, ≥30% 2+/3+ for expansion), ≥1 prior systemic therapy, ECOG 0-1, measurable disease, accessible lesions for biopsies, adequate organ function. Exclusion: Active CNS metastases/uncontrolled infections; recent major surgery/live vaccines; unresolved CTCAE ≥G2 toxicities (except alopecia/G2 neuropathy); autoimmune/inflammatory diseases (exceptions: stable hypothyroidism/vitiligo); strong CYP3A4 modulators; pregnancy/HIV-HBV-HCV (unless controlled); prior organ transplants. Corneal disorders may exclude per ophthalmologist assessment.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03816358  Clinical Status PHASE1
Clinical Description
A Phase I Study of Anetumab Ravtansine in Combination With Either Anti-PD-1 Antibody, or Anti-CTLA4 and Anti-PD-1 Antibodies or Anti-PD-1 Antibody and Gemcitabine in Mesothelin-Positive Advanced Pancreatic Adenocarcinoma
Primary Endpoint
The maximum tolerated dose (MTD) will be determined during the 30-37 day post-treatment period using a standard 3+3 dose escalation design.
Other Endpoint
Biomarker analysis (up to 100 days post-treatment) will explore CD8 changes pre- and post-treatment, utilizing paired T-tests and mixed models. Associations between biomarkers (baseline/dynamics) and clinical outcomes (PFS, toxicity, response) will be analyzed via Cox/logistic regression, with potential multiplicity adjustments (Pocock method).
Experiment 4 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Inclusion: Japanese patients (&ge;20 years) with ECOG 0-1, life expectancy &ge;12 weeks, advanced solid tumors (refractory/no standard therapy), measurable disease (RECIST 1.1), and adequate organ function. Exclusion: Recent anticancer therapy (<2 weeks), significant cardiac disease (CHF NYHA III/IV, recent MI/unstable angina, QTc >470 ms, LVEF <50%, uncontrolled hypertension), active HIV/HBV/HCV, LQTS history, or clinically significant eye disorders.

   Click to Show/Hide
Administration Dosage
Cohort 1: 4.5 mg/kg of BAY 94-9343 at Q3W dose regimen. Cohort 2: 6.5 mg/kg of BAY 94-9343 at Q3W dose regimen.
Related Clinical Trial
NCT Number NCT02485119  Clinical Status PHASE1
Clinical Description
An Open Label, Phase I Study to Evaluate the Safety, Tolerability and Pharmacokinetics of BAY94-9343 Given by Intravenous Infusion Every 3 Weeks (Q3W) in Japanese Subjects With Advanced Malignancies
Primary Endpoint
The study will assess treatment-emergent adverse events (TEAEs) graded by NCI CTCAE v4.03 over 9 weeks. Pharmacokinetic parameters (Cmax, AUC, tmax) for BAY94-9343, its total antibody compound, DM4, and metabolite DM4-Me will be measured across cycles (1-6) at multiple timepoints, including dose-normalized values (Cmax/D, AUC/D) and body-weight-adjusted metrics (Cmax,norm, AUCnorm) to evaluate drug exposure.

   Click to Show/Hide
Other Endpoint
Efficacy will be evaluated via RECIST criteria over 9 weeks, alongside mesothelin expression via IHC in tumor tissue and soluble mesothelin plasma levels. Immunogenicity will be monitored through anti-BAY94-9343 antibody counts.
Experiment 5 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Inclusion: Adults with unresectable, mesothelin-positive (&ge;10% tumor cells, 2+/3+ intensity) lung adenocarcinoma (stage IIIB/IV), prior platinum/immunotherapy, ECOG &le;2, measurable disease (RECIST), and adequate organ function. Exclusion: Concurrent cancers, uncontrolled CVD (NYHA III/IV CHF, recent MI/stroke, QTc >480 ms), active HBV/HCV/HIV, unresolved CTCAE >1 toxicity (except alopecia/anemia), recent major surgery/radiotherapy to target lesions, strong CYP3A4 modulators, or prior anetumab ravtansine exposure. Corneal disorders may disqualify per investigator assessment.

   Click to Show/Hide
Administration Dosage
Administered intravenously (IV) every 3 weeks
Related Clinical Trial
NCT Number NCT02839681  Clinical Status PHASE2
Clinical Description
Phase II Trial With Safety Run-in of the Anti-Mesothelin Antibody Drug Conjugate Anetumab Ravtansine for Mesothelin Expressing Lung Adenocarcinoma
Primary Endpoint
The Recommended Phase 2 Dose (RP2D) will be determined as the highest dose with ≤1 dose-limiting toxicity (DLT), defined as treatment-emergent adverse events (TEAEs) like prolonged grade 4 neutropenia during Cycle 1. Efficacy endpoints include the proportion of subjects achieving partial/complete response (≥30% reduction/disappearance of target lesions per RECIST), assessed at 6 weeks.

   Click to Show/Hide
Other Endpoint
Key secondary outcomes include progression-free survival (time to progression/death; RECIST-defined as ≥20% lesion growth + ≥5mm absolute increase), duration of response (time from CR/PR to progression), and overall survival (time to death from any cause). Safety will be monitored via CTCAE v4.0-graded serious/non-serious adverse events during the safety run-in phase (2 months).

   Click to Show/Hide
Experiment 6 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Inclusion: Advanced/metastatic NSCLC patients (Phase I: no standard therapy; Phase II: &ge;1 prior platinum regimen) with mesothelin expression (&ge;30% tumor cells, Ventana IHC 2+/3+), ECOG 0-1, measurable disease (Phase II), and adequate organ function. Exclusion: Prior anti-PD-1/PD-L1 therapy (except anti-CTLA-4 with specific criteria), CNS metastases (unless asymptomatic/stable), uncontrolled CVD (NYHA III/IV CHF, recent angina/MI), active infections, autoimmune diseases (exceptions for stable conditions), recent major surgery/radiotherapy, or corneal disorders. Pregnant women and those with untreated HBV/HCV or severe immunosuppression are excluded.

   Click to Show/Hide
Administration Dosage
Participants receive anetumab ravtansine IV over 60 minutes and atezolizumab IV over 30-60 minutes on day 1. Courses repeat every 21 days in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT03455556  Clinical Status PHASE1
Clinical Description
Phase I/II Study of the Human Anti-Mesothelin Antibody Drug Conjugate Anetumab Ravtansine (AR), Combined With the PD-L1 Inhibitor Atezolizumab in Non-Small Cell Lung Cancer
Primary Endpoint
The Phase I portion aims to determine the Maximum Tolerated Dose (MTD) of anetumab ravtansine combined with atezolizumab, defined as the highest dose level where ≤1 out of 6 patients experience dose-limiting toxicities (DLTs) within 21 days. In Phase II, efficacy will be assessed via the confirmed response rate (CR/PR on two consecutive scans ≥4 weeks apart), analyzed using exact binomial 95% CIs.

   Click to Show/Hide
Other Endpoint
Phase I will evaluate clinical activity (CR, PR, SD, PD via descriptive statistics) and adverse event incidence (CTCAE v4.0 graded) over 21 days post-treatment. Phase II endpoints include overall survival (time to death, Kaplan-Meier estimation up to 2 years), progression-free survival (time to progression/death; 1- and 2-year rates reported), and safety monitoring.

   Click to Show/Hide
Experiment 7 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Inclusion: Malignant pleural mesothelioma patients (post-platinum therapy, mesothelin-positive [&ge;30% tumor cells], measurable disease per RECIST/mRECIST) with ECOG <2, adequate organ function, and contraception compliance. Exclusion: Active brain metastases, recent anti-PD-1/PD-L1 therapy, unresolved CTCAE >1 toxicity (except neuropathy/alopecia), CYP3A4 modulators, pregnancy, HIV/HBV/HCV (unless controlled), corneal epitheliopathy, or interstitial lung disease. Prior transfusions/G-CSF within 4 weeks or live vaccines within 30 days are prohibited.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03126630  Clinical Status PHASE1|||PHASE2
Clinical Description
Phase 1 Safety Run-In and Phase 2 Randomized Clinical Trial of Anetumab Ravtansine and Pembrolizumab (MK-3475) Compared to Pembrolizumab Alone for Mesothelin-Positive Malignant Pleural Mesothelioma
Primary Endpoint
The Phase II portion will evaluate confirmed tumor response rate (CR + PR per RECIST 1.1) over 2 years, comparing treatment arms via one-sided z-test (alpha=0.10). The Phase I component will determine the Recommended Phase 2 Dose (RP2D) of anetumab ravtansine combined with pembrolizumab, assessing toxicity in all treated patients (DLT evaluability excludes non-toxicity-related discontinuations).

   Click to Show/Hide
Other Endpoint
Key Phase II endpoints include duration of response (Kaplan-Meier estimation from treatment start, log-rank test for arm comparison), overall survival (death from any cause, Kaplan-Meier/log-rank), and progression-free survival (time to progression/death per RECIST 1.1). Pharmacodynamic analyses will correlate megakaryocyte potentiating factor levels with response (Wilcoxon/Jonckheere-Terpstra tests) and explore mononuclear phagocyte system biomarkers (linear regression). Adverse events will be tracked via PRO-CTCAE over 2 years.

   Click to Show/Hide
Experiment 8 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Inclusion Criteria: Mesothelin-overexpressing, unresectable/advanced MPM post-1st-line platinum/pemetrexed, measurable disease, ECOG 0-1, adequate organ function, LVEF &ge;50%. Exclusion Criteria: >1 prior therapy, active eye/corneal disorders, CNS metastases, bleeding diathesis, CTCAE Grade >2 infections, or significant cardiac conditions.
Administration Dosage
Starting dose: 6.5 mg/kg administered as IV infusion over 1 h every 3 weeks until disease progression or treatment withdrawal for any reason. Dose reductions are permitted.
Related Clinical Trial
NCT Number NCT02610140  Clinical Status PHASE2
Clinical Description
A Randomized, Open-label, Active-controlled, Phase II Study of Intravenous Anetumab Ravtansine (BAY 94-9343) or Vinorelbine in Patients With Advanced or Metastatic Malignant Pleural Mesothelioma Overexpressing Mesothelin and Progressed on First Line Platinum/Pemetrexed-based Chemotherapy
Primary Endpoint
The study assessed Progression-Free Survival (PFS) as the time from randomization to disease progression (per mRECIST) or death, with follow-up until ~117 PFS events occurred (data cutoff: May-2017). Only descriptive overall survival (OS) analysis was repeated in later follow-ups.
Other Endpoint
Key efficacy endpoints included OS (time to death; log-rank test), Objective Response Rate (ORR, CR+PR per mRECIST), Disease Control Rate (DCR, CR+PR+SD), Duration of Response (DOR), and Durable Response Rate (DRR, response ≥180 days). Symptom improvement (MDASI-MPM) and pain metrics (TTWP, improvement rates) were tracked. Treatment-emergent adverse events (TEAEs) and fatal outcomes were analyzed through Jul-2019.

   Click to Show/Hide
Experiment 9 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Inclusion Criteria: Adults (&ge;18) with unresectable epithelial mesothelioma or nonsquamous NSCLC (chemotherapy-naive or pretreated, though NSCLC subjects must have received FDA-approved therapies first) and measurable disease (RECIST 1.1/mRECIST), ECOG 0-1, life expectancy &ge;12 weeks, and adequate organ function. Exclusion Criteria: Prior/distinct cancers (unless cured >3 years prior), bleeding disorders (CTCAE &ge;G2), active CNS metastases, uncontrolled cardiovascular disease (NYHA III/IV), hypertension (&ge;160/100 mmHg), biliary obstruction, organ transplantation, drug hypersensitivity, active HBV/HCV/HIV, serious infections (CTCAE &ge;G2), recent anticancer therapies/radiotherapy (within 4 weeks), or anticoagulation started within 2 weeks pre-treatment.

   Click to Show/Hide
Administration Dosage
Investigating the combination of anetumab ravtansine (BAY 94-9343) with Pemetrexed (500 mg/m2) and Cisplatin (75 mg/m2) in Part 1 (dose escalation cohorts) and Part 2 (two MTD expansion cohorts).
Related Clinical Trial
NCT Number NCT02639091  Clinical Status PHASE1
Clinical Description
An Open Label Phase Ib Dose Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Immunogenicity and Maximum Tolerated Dose of Anetumab Ravtansine in Combination With Pemetrexed 500 mg/m2 and Cisplatin 75 mg/m2 in Subjects With Mesothelin-expressing Predominantly Epithelial Mesothelioma or Nonsquamous Non-small-cell Lung Cancer
Primary Endpoint
The study aimed to determine the maximum tolerated dose (MTD) of oral anetumab ravtansine combined with IV pemetrexed and cisplatin, defined as the highest dose where ≤1 of 6 subjects experienced dose-limiting toxicity (DLT). Safety and tolerability were assessed through adverse events (AEs) and serious AEs (SAEs) over 2 years.
Other Endpoint
Pharmacokinetics included plasma concentrations of anetumab ravtansine (sampled at multiple timepoints), pemetrexed (Cycle 1 Days 1-3), and cisplatin (Cycle 1 Days 1-3). Tumor response was evaluated per mRECIST (every 8 weeks initially, then every 12 weeks). Anti-drug antibodies were monitored periodically (Day 1 of Cycles 1, 3, 6, etc.).
Experiment 10 Reporting the Activity Date of This ADC [10]
Efficacy Data Objective Response Rate (ORR)
9.60%
Moderate MSLN expresion (MSLN++; 135,000-480,000 CD48 molecules/cell)
Patients Enrolled
Unresectable locally advanced or metastatic malignant pleural mesothelioma, an Eastern Cooperative Oncology Group performance status of 0-1, and who had progressed on first-line platinum-pemetrexed chemotherapy with or without bevacizumab.
Administration Dosage
Anetumab ravtansine (6.50 mg/kg once every 3 weeks) via intravenous infusion for 1 h on day 1 of each 21-day cycle, or vinorelbine (30 mg/m2 once every week) via intravenous injection for 610 min.
Related Clinical Trial
NCT Number NCT02610140  Clinical Status Phase 2
Clinical Description
A randomized, open-label, active-controlled, phase 2 study of intravenous anetumab ravtansine (BAY 94-9343) or vinorelbine in patients with advanced or metastatic malignant pleural mesothelioma overexpressing mesothelin and progressed on first line platinum/pemetrexed-based chemotherapy.
Primary Endpoint
For 6.50 mg/kg anetumab ravtansine,median progression-free survival 4.30 months [95% CI 41.00-52.00].
Experiment 11 Reporting the Activity Date of This ADC [11]
Efficacy Data Objective Response Rate (ORR)
27.70
42.10 %
High MSLN expresion (MSLN+++; 19,998 MSLN molecules/cell)
Patients Enrolled
Predominantly epithelial (>50% of tumor component) platinum-resistant recurrent ovarian, fallopian tube, or primary peritoneal cancer.
Administration Dosage
Anetumab ravtansine (5.50 or 6.50 mg/kg) and pegylated liposomal doxorubicin (30 mg/m2) were administered intravenously every 3 weeks to 65 patients with platinum-resistant epithelial ovarian cancer.
Related Clinical Trial
NCT Number NCT02751918  Clinical Status Phase 1b
Clinical Description
An open-label phase 1b dose escalation study to evaluate the safety, tolerability, pharmacokinetics, immunogenicity and maximum tolerated dose of anetumab ravtansine in combination with pegylated liposomal doxorubicin 30 mg/m2 given every 3 weeks in subjects with mesothelin-expressing platinum-resistant recurrent ovarian, fallopian tube or primary peritoneal cancer.

   Click to Show/Hide
Primary Endpoint
The maximum tolerated dose of anetumab ravtansine in combination was 6.50 mg/kg administered every 3 weeks. No patient experienced a dose-limiting toxicity at either dose in the dose escalation cohort.
Other Endpoint
In all treated patients, ORR=27.70% (95% CI 17.30% to 40.20%), including one complete (1.50%) and 17 partial responses (26.20%). Mdor=7.60 months (95% CI 3.30 to 10.20), mPFS=5.0 months (95% CI 3.20 to 6.00). In high mesothelin expression patients (N=19), who received 3 prior lines of systemic therapy, ORR=42.10% (95% CI 20.30% to 66.50%), mDOR=8.30 months (95% CI 4.10 to 12.00), mFPS=8.50 months (95% CI 4.00 to 11.40).

   Click to Show/Hide
Experiment 12 Reporting the Activity Date of This ADC [12]
Efficacy Data Objective Response Rate (ORR)
31%
Moderate MSLN expresion (MSLN++; 1105 MSLN molecules/cell)
Patients Enrolled
Advanced, metastatic, or recurrent solid tumors refractory to standard therapy.
Administration Dosage
0.15, 0.30, 0.60, 1.20, 2.40, 3.60, 4.50, 5.50, 6.50, and 7.50 mg/kg once every 3 weeks.
Related Clinical Trial
NCT Number NCT01439152  Clinical Status Phase 1
Clinical Description
An open label phase 1 dose escalation study to evaluate the safety, tolerability, pharmacokinetics, pharmacodynamics, and maximum tolerated dose of the anti-mesothelin antibody drug conjugate BAY94-9343 in subjects with advanced solid tumors.
Experiment 13 Reporting the Activity Date of This ADC [13]
Related Clinical Trial
NCT Number NCT02610140  Clinical Status Phase 2
Clinical Description
A randomized, open-label, active-controlled, phase 2 study of intravenous anetumab ravtansine (BAY 94-9343) or vinorelbine in patients with advanced or metastatic malignant pleural mesothelioma overexpressing mesothelin and progressed on first line platinum/pemetrexed-based chemotherapy.
Experiment 14 Reporting the Activity Date of This ADC [14]
Related Clinical Trial
NCT Number NCT03587311  Clinical Status Phase 2
Clinical Description
A randomized phase 2 study of bevacizumab and either weekly anetumab ravtansine or weekly paclitaxel in platinum-resistant or platinum refractory ovarian cancer.
Experiment 15 Reporting the Activity Date of This ADC [15]
Related Clinical Trial
NCT Number NCT02839681  Clinical Status Phase 2
Clinical Description
Phase 2 trial with safety run-in of the anti-mesothelin antibody drug conjugate anetumab ravtansine for mesothelin expressing lung adenocarcinoma.
Experiment 16 Reporting the Activity Date of This ADC [16]
Related Clinical Trial
NCT Number NCT03023722  Clinical Status Phase 2
Clinical Description
An open-label, phase 2 study of intravenous anetumab ravtansine (BAY 94-9343), an anti-mesothelin antibody drug conjugate, in pretreated mesothelin-expressing advanced pancreatic cancer.
Experiment 17 Reporting the Activity Date of This ADC [17]
Related Clinical Trial
NCT Number NCT03926143  Clinical Status Phase 2
Clinical Description
An open-label, multicenter rollover study to provide continued treatment with anetumab ravtansine for participants with solid tumors who were enrolled in previous bayer-sponsored studies.
Experiment 18 Reporting the Activity Date of This ADC [18]
Related Clinical Trial
NCT Number NCT03126630  Clinical Status Phase 1/2
Clinical Description
Phase 1 safety run-in and phase 2 randomized clinical trial of anetumab ravtansine and pembrolizumab (MK-3475) compared to pembrolizumab alone for mesothelin-positive malignant pleural mesothelioma.
Experiment 19 Reporting the Activity Date of This ADC [19]
Related Clinical Trial
NCT Number NCT02485119  Clinical Status Phase 1
Clinical Description
An open label, phase 1 study to evaluate the safety, tolerability and pharmacokinetics of BAY94-9343 given by intravenous infusion every 3 weeks (Q3W) in Japanese subjects with advanced malignancies.
Experiment 20 Reporting the Activity Date of This ADC [20]
Related Clinical Trial
NCT Number NCT03816358  Clinical Status Phase 1
Clinical Description
A phase 1 study of anetumab ravtansine in combination with either anti-PD-1 antibody, or anti-CTLA4 and anti-PD-1 antibodies or anti-PD-1 antibody and gemcitabine in mesothelin-positive advanced pancreatic adenocarcinoma.
Experiment 21 Reporting the Activity Date of This ADC [21]
Related Clinical Trial
NCT Number NCT02639091  Clinical Status Phase 1
Clinical Description
An open label phase 1b dose escalation study to evaluate the safety, tolerability, pharmacokinetics, immunogenicity and maximum tolerated dose of anetumab ravtansine in combination with pemetrexed 500 mg/m2 and cisplatin 75 mg/m2 in subjects with mesothelin-expressing predominantly epithelial mesothelioma or nonsquamous non-small-cell lung cancer.

   Click to Show/Hide
Experiment 22 Reporting the Activity Date of This ADC [22]
Patients Enrolled
Unresectable locally advanced or metastatic recurrent or relapsing disease.
Administration Dosage
Mesothelin-positive patients with selected adenocarcinomas (NSCLC, triple negative breast, gastric including gastroesophageal junction) and thymic carcinoma will receive anetumab ravtansine as monotherapy at 6.50 mg/kg IV on a 21-day cycle. Patients with cholangiocarcinoma will receive anetumab ravtansine in combination with cisplatin (25 mg/m2 IV day 1 and 8 on a 21-day cycle for up to 6 cycles) and patients with pancreatic adenocarcinoma will receive anetumab ravtansine in combination with gemcitabine (1000 mg/m2 IV day 1 and 8 on a 21-day cycle).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03102320  Clinical Status Phase 1
Clinical Description
Phase 1b multi-indication study of anetumab ravtansine (BAY94-9343) in patients with mesothelin expressing advanced or recurrent malignancies.
Experiment 23 Reporting the Activity Date of This ADC [23]
Related Clinical Trial
NCT Number NCT02824042  Clinical Status Phase 1
Clinical Description
An open label, phase 1 study to assess the effect of itraconazole (CYP3A4 and P-gp Inhibitor) on the pharmacokinetics of anetumab ravtansine and to assess the ECG Effects, safety and immunogenicity of anetumab ravtansine given as a single agent and together with itraconazole in subjects with mesothelin-expressing advanced solid cancers.
Experiment 24 Reporting the Activity Date of This ADC [24]
Related Clinical Trial
NCT Number NCT03455556  Clinical Status Phase 1
Clinical Description
Phase 1/2 study of the human anti-mesothelin antibody drug conjugate anetumab ravtansine (AR), combined with the PD-L1 inhibitor atezolizumab in non-small cell lung cancer.
Experiment 25 Reporting the Activity Date of This ADC [25]
Related Clinical Trial
NCT Number NCT02696642  Clinical Status Phase 1
Clinical Description
An open label phase 1 study to evaluate the safety, tolerability, pharmacokinetics and immunogenicity of anetumab ravtansine in subjects with mesothelin-expressing advanced solid cancers and different stages of concurrent hepatic or renal impairment.
Experiment 26 Reporting the Activity Date of This ADC [26]
Related Clinical Trial
NCT Number NCT02751918  Clinical Status Phase 1
Clinical Description
An open-label phase 1b dose escalation study to evaluate the safety, tolerability, pharmacokinetics, immunogenicity and maximum tolerated dose of anetumab ravtansine in combination with pegylated liposomal doxorubicin 30 mg/m2 given every 3 weeks in subjects with mesothelin-expressing platinum-resistant recurrent ovarian, fallopian tube or primary peritoneal cancer.

   Click to Show/Hide
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 43 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [27]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0% Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: T1889)
Experiment 2 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
0%
Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: Cx-03)
Experiment 3 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
0%
High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing cervical squamous cell carcinoma PDX model (PDX: Caski)
Experiment 4 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 16.70% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.03 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing mesothelioma PDX model (PDX: NCI-H226)
Experiment 5 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
25%
High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: Cx-03)
Experiment 6 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
27%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing serous papillary carcinoma PDX model (PDX: ST206B)
Experiment 7 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 35.10% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3x106 MIA PaCa-2/vector,3x106 MIA PaCa-2/meso, 1x106 HT-29/vector, 1x106 HT-29/meso ,3x106 OVCAR-3, or 3x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.01 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing pancreatic carcinoma PDX model (PDX: MIA PaCa-2/meso)
Experiment 8 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
42%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: OVCAR-8)
Experiment 9 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
42%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: OVCAR-8)
Experiment 10 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
49%
Moderate MSLN expression (MSLN++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: ST081)
Experiment 11 Reporting the Activity Date of This ADC [27]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 52.50% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: T1889)
Experiment 12 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
54%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: OVCAR-8)
Experiment 13 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
57.10%
High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: Cx-03)
Experiment 14 Reporting the Activity Date of This ADC [27]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 63.10% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: T1889)
Experiment 15 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
64%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: Ov6668)
Experiment 16 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
64%
Moderate MSLN expression (MSLN++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous papillary carcinoma PDX model (PDX: ST409)
Experiment 17 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 64.30% Low Mesothelin expression (MSLN+; IHC 1+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing colon carcinoma model PDX model (PDX: HT-29/meso)
Experiment 18 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
65%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: OVCAR-8)
Experiment 19 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 66.70% Low Mesothelin expression (MSLN+; IHC 1+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.03 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing mesothelioma PDX model (PDX: NCI-H226)
Experiment 20 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
73%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: Ov6668)
Experiment 21 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
74%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: ST081)
Experiment 22 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
75%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing serous papillary carcinoma PDX model (PDX: ST467)
Experiment 23 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
83%
Negative Mesothelin expression (MSLN-)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: Ov6668)
Experiment 24 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
83%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: OVCAR-3)
Experiment 25 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83.30% Low Mesothelin expression (MSLN+; IHC 1+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3x106 MIA PaCa-2/vector, 3x106 MIA PaCa-2/meso,1x106 HT-29/vector, 1x106 HT-29/meso, 3x106 OVCAR-3, or 3x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. BAY 94-9343 administered at 0.05 mg/kg, 0.2 mg/kg (corresponding to 14.3 mg/kg ADC; Q3Dx3).

   Click to Show/Hide
In Vivo Model Ovarian cancer PDX model (PDX: OVCAR6719)
Experiment 26 Reporting the Activity Date of This ADC [27]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83.90% Low Mesothelin expression (MSLN+; IHC 1+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: T1889)
Experiment 27 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
85%
Negative Mesothelin expression (MSLN-)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: ST081)
Experiment 28 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
90%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: OVCAR-3)
Experiment 29 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Low Mesothelin expression (MSLN+; IHC 1+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3x106 MIA PaCa-2/vector, 3x106 MIA PaCa-2/meso,1x106 HT-29/vector, 1x106 HT-29/meso, 3x106 OVCAR-3, or 3x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. BAY 94-9343 administered at 0.05 mg/kg, 0.2 mg/kg (corresponding to 14.3 mg/kg ADC; Q3Dx3).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing pancreatic tumor PDX model (PDX: PAXF736)
Experiment 30 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90.40% Low MSLN expresion (MSLN+; 900 MSLN molecules/cell)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: OVCAR-36)
Experiment 31 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90.60% High MSLN expresion (MSLN+++; 41,887 MSLN molecules/cell)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.03 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing mesothelioma PDX model (PDX: NCI-H226)
Experiment 32 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.20% Moderate MSLN expresion (MSLN++; 1,260 MSLN molecules/cell)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g,7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.01 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: OVCAR-36)
Experiment 33 Reporting the Activity Date of This ADC [27]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 94.70% High MSLN expresion (MSLN+++; 53,497 MSLN molecules/cell)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing uterine carcinosarcoma PDX model (PDX: T1889)
Experiment 34 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
96%
Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing ovarian cancer PDX model (PDX: OVCAR-3)
Experiment 35 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
96%
Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous papillary carcinoma PDX model (PDX: ST270)
Experiment 36 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade ovarian cancer PDX model (PDX: ST103)
Experiment 37 Reporting the Activity Date of This ADC [30]
Efficacy Data Tumor Growth Inhibition value (TGI)
100%
Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive ovarian cancer cell line- and patient-derived xenograft models. For the OVCAR-3 and OVCAR-8 xenograft models,tumor cells in Matrigel were inoculated subcutaneously to the right lower flank region of female nude/nude mice. In the monotherapy experiments,anetumab ravtansine was administered intravenously (i.v.) at 2.5 mg/kg three times every third day (Q3Dx3). For the in vivo combination studies with pegylated liposomal doxorubicin (PLD) or copanlisib in OVCAR-8 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,7,28,32 and 35,or on days 1,4,28 and 35,respectively. For the in vivo combination studies in OVCAR-3 xenografts,anetumab ravtansine was administered i.v. at 2.5 mg/kg on days 1,4,43 and 46. For the Ov6668 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg on day 1 and at 15 mg/kg on days 16,30,43,57 and 71. For the ST081 xenografts,anetumab ravtansine was administered i.v. at 3.75 mg/kg every second week (Q2W). PLD was administered i.v. at 4 mg/kg on days 1,7,28 and 35 (OVCAR-8 xenografts),on days 1 and 30 (Ov6668 xenografts) or on days 0 and 7 (ST081 xenografts). Carboplatin was administered i.v. at 80 mg/kg QWx2. Copanlisib was administered at 10 mg/kg,2 days on/5 days off,i.v.,starting on day 2. Bevacizumab was administered intraperitoneally (i.p.) at 0.3 mg/kg,every fifth day (Q5D).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing high-grade serous ovarian cancer PDX model (PDX: ST081)
Experiment 38 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. BAY 94-9343 administered at 0.05 mg/kg,0.2 mg/kg (corresponding to 14.3 mg/kg ADC; Q3Dx3).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing mesothelioma model PDX model (PDX: Meso7212)
Experiment 39 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. BAY 94-9343 administered at 0.05 mg/kg,0.2 mg/kg (corresponding to 14.3 mg/kg ADC; Q3Dx3).

   Click to Show/Hide
In Vivo Model Mesothelin-expressing mesothelioma model PDX model (PDX: Meso7212)
Experiment 40 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. BAY 94-9343 administered at 0.05 mg/kg,0.2 mg/kg (corresponding to 14.3 mg/kg ADC; Q3Dx3).

   Click to Show/Hide
In Vivo Model Ovarian cancer PDX model (PDX: OVCAR6719)
Experiment 41 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High Mesothelin expression (MSLN+++; IHC 3+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.01 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing colon carcinoma model PDX model (PDX: HT-29/meso)
Experiment 42 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.01 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing pancreatic carcinoma PDX model (PDX: MIA PaCa-2/meso)
Experiment 43 Reporting the Activity Date of This ADC [29]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Moderate Mesothelin expression (MSLN++; IHC 2+)
Method Description
For subcutaneous tumor models,female NMRI nu/nu mice (18-25 g, 7-10 weeks) from Taconic M&B were implanted on day 0 with either 3 x106 MIA PaCa-2/vector,3 x106 MIA PaCa-2/meso,1 x106 HT-29/vector,1 x106 HT-29/meso,3 x106 OVCAR-3,or 3 x106 NCI-H226 cells suspended in 0.1 mL 50% Matrigel. Patient-derived pancreatic (PAXF736) model was performed at Oncotest GmbH and ovarian (OVCAR6719) and mesothelioma (Meso7212) models at EPO Berlin-Buch GmbH. 0.01 mg/kg , 0.05 mg/kg , 0.2 mg/kg Anetumab ravtansine was i.v. to the tumor-bearing mice.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing pancreatic carcinoma PDX model (PDX: MIA PaCa-2/meso)
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [31]
Efficacy Data Tumor Growth Inhibition value (TGI)
25%
High MSLN expression (MSLN+++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Four groups of mice,each consisting of 58 animals was set up and vital Hela cells were inoculated in a dose of 110e5 cells in 100 l by subcutaneous injection in the left inner flank on day 0. Animals in the treatment groups received 2 mg/kg,5 mg/kg,and 10 mg/kg anetumab ravtansine in 200 l injection buffer twice weekly by i.p. injection. Animals in the control group received injection buffer only.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Experiment 2 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
25%
High MSLN expression (MSLN+++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing cervical squamous cell carcinoma hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Experiment 3 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
50%
High MSLN expression (MSLN+++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing cervical squamous cell carcinoma hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Experiment 4 Reporting the Activity Date of This ADC [31]
Efficacy Data Tumor Growth Inhibition value (TGI)
75%
Negative MSLN expression (MSLN-)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Four groups of mice,each consisting of 58 animals was set up and vital Hela cells were inoculated in a dose of 110e5 cells in 100 l by subcutaneous injection in the left inner flank on day 0. Animals in the treatment groups received 2 mg/kg,5 mg/kg,and 10 mg/kg anetumab ravtansine in 200 l injection buffer twice weekly by i.p. injection. Animals in the control group received injection buffer only.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Experiment 5 Reporting the Activity Date of This ADC [28]
Efficacy Data Tumor Growth Inhibition value (TGI)
85.70%
Moderate MSLN expression (MSLN++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Mice were subcutaneously inoculated with 5x106 MSLN positive T1889 cells mixed with Matrigel. Treatment then began, and the experiments ran for a total of 4 weeks. The first treatment cohort of 32 mice consisted of vehicle control, isotype ADC control, and 15 mg/kg ARav, dosed at Q7D via intraperitoneal injection. A second treatment cohort of 30 mice occurred with groups consisting of vehicle control (Q14D), 7.5 mg/kg ARav (Q14D) monotherapy, 7.5 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy. A third treatment cohort of 32 mice occurred with groups consisting of vehicle control (Q14D), 3.75 mg/kg ARav (Q14D) monotherapy, 3.75 mg/kg ARav (Q14D) and 4 mg/kg cisplatin (Q7D) combination therapy, and 4 mg/kg cisplatin (Q7D) monotherapy.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing cervical squamous cell carcinoma hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Experiment 6 Reporting the Activity Date of This ADC [31]
Efficacy Data Tumor Growth Inhibition value (TGI)
88%
Positive Mesothelin expression (MSLN+++/++)
Method Description
The in vivo antitumor activity of Anetumab ravtansine was evaluated in a Mesothelin positive xenograft tumor models. Four groups of mice,each consisting of 58 animals was set up and vital Hela cells were inoculated in a dose of 110e5 cells in 100 l by subcutaneous injection in the left inner flank on day 0. Animals in the treatment groups received 2 mg/kg,5 mg/kg,and 10 mg/kg anetumab ravtansine in 200 l injection buffer twice weekly by i.p. injection. Animals in the control group received injection buffer only.

   Click to Show/Hide
In Vivo Model Mesothelin-expressing hela CDX model
In Vitro Model Endocervical adenocarcinoma HeLa cells CVCL_0030
Revealed Based on the Cell Line Data
Click To Hide/Show 16 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Pancreatic ductal adenocarcinoma MIA PaCa-2 cells CVCL_0428
Experiment 2 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.05 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Colon adenocarcinoma HT-29 cells CVCL_0320
Experiment 3 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.59 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian serous adenocarcinoma OVCAR-3 cells CVCL_0465
Experiment 4 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.59 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Pancreatic ductal adenocarcinoma MIA PaCa-2 cells (MSLN expression) CVCL_0428
Experiment 5 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.1 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian serous cystadenocarcinoma SK-OV-3 cells CVCL_0532
Experiment 6 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.72 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Pleural epithelioid mesothelioma NCI-H226 cells CVCL_1544
Experiment 7 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.9 nM
Low MSLN expresion (MSLN+; 952 MSLN molecules/cell)
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian adenocarcinoma BG1 cells CVCL_6570
Experiment 8 Reporting the Activity Date of This ADC [29]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
7.15 nM
Method Description
The inhibitory activity of BAY 94-9343 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Colon adenocarcinoma HT-29 cells (MSLN expression) CVCL_0320
Experiment 9 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
10.9 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian serous adenocarcinoma OVCAR-3 cells CVCL_0465
Experiment 10 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
11.9 nM
Moderate MSLN expresion (MSLN++; 3,875 MSLN molecules/cell)
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian serous adenocarcinoma OVCAR-5 cells CVCL_1628
Experiment 11 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
15.4 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Pancreatic ductal adenocarcinoma HPAF-II cells CVCL_0313
Experiment 12 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
20.7 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian endometrioid adenocarcinoma A2780 cells CVCL_0134
Experiment 13 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
20.8 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian serous cystadenocarcinoma EFO-21 cells CVCL_0029
Experiment 14 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
32.5 nM
Moderate MSLN expresion (MSLN++; 9,648 MSLN molecules/cell)
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model High grade ovarian serous adenocarcinoma OVCAR-8 cells CVCL_1629
Experiment 15 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
41.9 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 16 Reporting the Activity Date of This ADC [30]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
42.4 nM
Method Description
The inhibitory activity of anetumab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model High grade ovarian serous adenocarcinoma NCI-ADR-RES cells CVCL_1452
References
Ref 1 Bevacizumab and Anetumab Ravtansine or Paclitaxel in Treating Patients With Refractory Ovarian, Fallopian Tube, or Primary Peritoneal Cancer
Ref 2 Phase II Anetumab Ravtansine in Pre-treated Mesothelin-expressing Pancreatic Cancer
Ref 3 Testing the Combination of Anetumab Ravtansine With Either Nivolumab, Nivolumab and Ipilimumab, or Gemcitabine and Nivolumab in Advanced Pancreatic Cancer
Ref 4 Phase I Dose Escalation Study of BAY94-9343 Given by Intravenous Infusion Every 3 Weeks in Japanese Subjects With Advanced Malignancies
Ref 5 Anti-Mesothelin Antibody Drug Conjugate Anetumab Ravtansine for Mesothelin Expressing Lung Adenocarcinoma
Ref 6 Anetumab Ravtansine and Atezolizumab in Treating Participants With Advanced Non-small Cell Lung Cancer
Ref 7 Pembrolizumab With or Without Anetumab Ravtansine in Treating Patients With Mesothelin-Positive Pleural Mesothelioma
Ref 8 Phase II Anetumab Ravtansine as 2nd Line Treatment for Malignant Pleural Mesothelioma (MPM)
Ref 9 Phase Ib Study of Anetumab Ravtansine in Combination With Pemetrexed and Cisplatin in Mesothelin-expressing Solid Tumors
Ref 10 Anetumab ravtansine versus vinorelbine in patients with relapsed, mesothelin-positive malignant pleural mesothelioma (ARCS-M): a randomised, open-label phase 2 trial. Lancet Oncol. 2022 Apr;23(4):540-552.
Ref 11 Safety and activity of anti-mesothelin antibody-drug conjugate anetumab ravtansine in combination with pegylated-liposomal doxorubicin in platinum-resistant ovarian cancer: multicenter, phase Ib dose escalation and expansion study. Int J Gynecol Cancer. 2023 Apr 3;33(4):562-570.
Ref 12 First-in-Human, Multicenter, Phase I Dose-Escalation and Expansion Study of Anti-Mesothelin Antibody-Drug Conjugate Anetumab Ravtansine in Advanced or Metastatic Solid Tumors. J Clin Oncol. 2020 Jun 1;38(16):1824-1835. doi: 10.1200/JCO.19.02085.
Ref 13 A Randomized, Open-label, Active-controlled, Phase II Study of Intravenous Anetumab Ravtansine (BAY 94-9343) or Vinorelbine in Patients With Advanced or Metastatic Malignant Pleural Mesothelioma Overexpressing Mesothelin and Progressed on First Line Platinum/Pemetrexed-based Chemotherapy, NCT02610140
Ref 14 A Randomized Phase 2 Study of Bevacizumab and Either Weekly Anetumab Ravtansine or Weekly Paclitaxel in Platinum-Resistant or Platinum Refractory Ovarian Cancer, NCT03587311
Ref 15 Phase II Trial With Safety Run-in of the Anti-Mesothelin Antibody Drug Conjugate Anetumab Ravtansine for Mesothelin Expressing Lung Adenocarcinoma, NCT02839681
Ref 16 An Open-label, Phase II Study of Intravenous Anetumab Ravtansine (BAY 94-9343), an Anti-mesothelin Antibody Drug Conjugate, in Pretreated Mesothelin-expressing Advanced Pancreatic Cancer, NCT03023722
Ref 17 An Open-label, Multicenter Rollover Study to Provide Continued Treatment With Anetumab Ravtansine for Participants With Solid Tumors Who Were Enrolled in Previous Bayer-sponsored Studies, NCT03926143
Ref 18 Phase 1 Safety Run-In and Phase 2 Randomized Clinical Trial of Anetumab Ravtansine and Pembrolizumab (MK-3475) Compared to Pembrolizumab Alone for Mesothelin-Positive Malignant Pleural Mesothelioma, NCT03126630
Ref 19 An Open Label, Phase I Study to Evaluate the Safety, Tolerability and Pharmacokinetics of BAY94-9343 Given by Intravenous Infusion Every 3 Weeks (Q3W) in Japanese Subjects With Advanced Malignancies, NCT02485119
Ref 20 A Phase I Study of Anetumab Ravtansine in Combination With Either Anti-PD-1 Antibody, or Anti-CTLA4 and Anti-PD-1 Antibodies or Anti-PD-1 Antibody and Gemcitabine in Mesothelin-Positive Advanced Pancreatic Adenocarcinoma, NCT03816358
Ref 21 An Open Label Phase Ib Dose Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Immunogenicity and Maximum Tolerated Dose of Anetumab Ravtansine in Combination With Pemetrexed 500 mg/m2 and Cisplatin 75 mg/m2 in Subjects With Mesothelin-expressing Predominantly Epithelial Mesothelioma or Nonsquamous Non-small-cell Lung Cancer, NCT02639091
Ref 22 Phase 1b multi-indication study of the antibody drug conjugate anetumab ravtansine in patients with mesothelin-expressing advanced or recurrent malignancies. Ann. Oncol. 2017 Sept; 28(5):Supplement V141.
Ref 23 An Open Label, Phase I Study to Assess the Effect of Itraconazole (CYP3A4 and P-gp Inhibitor) on the Pharmacokinetics of Anetumab Ravtansine and to Assess the ECG Effects, Safety and Immunogenicity of Anetumab Ravtansine Given as a Single Agent and Together With Itraconazole in Subjects With Mesothelin-expressing Advanced Solid Cancers, NCT02824042
Ref 24 Phase I/II Study of the Human Anti-Mesothelin Antibody Drug Conjugate Anetumab Ravtansine (AR), Combined With the PD-L1 Inhibitor Atezolizumab in Non-Small Cell Lung Cancer, NCT03455556
Ref 25 An Open Label Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Immunogenicity of Anetumab Ravtansine in Subjects With Mesothelin-expressing Advanced Solid Cancers and Different Stages of Concurrent Hepatic or Renal Impairment, NCT02696642
Ref 26 An Open-label Phase Ib Dose Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Immunogenicity and Maximum Tolerated Dose of Anetumab Ravtansine in Combination With Pegylated Liposomal Doxorubicin 30 mg/m2 Given Every 3 Weeks in Subjects With Mesothelin-expressing Platinum-resistant Recurrent Ovarian, Fallopian Tube or Primary Peritoneal Cancer, NCT02751918
Ref 27 Exploiting mesothelin in thymic carcinoma as a drug delivery target for anetumab ravtansine. Br J Cancer. 2022 Mar;126(5):754-763.
Ref 28 Favorable therapeutic response after anti-Mesothelin antibody-drug conjugate treatment requires high expression of Mesothelin in tumor cells. Arch Gynecol Obstet. 2020 Nov;302(5):1255-1262.
Ref 29 Anetumab ravtansine: a novel mesothelin-targeting antibody-drug conjugate cures tumors with heterogeneous target expression favored by bystander effect. Mol Cancer Ther. 2014 Jun;13(6):1537-48.
Ref 30 Anetumab ravtansine inhibits tumor growth and shows additive effect in combination with targeted agents and chemotherapy in mesothelin-expressing human ovarian cancer models. Oncotarget. 2018 Sep 25;9(75):34103-34121.
Ref 31 Mesothelin as a target for cervical cancer therapy. Arch Gynecol Obstet. 2019 Jan;299(1):211-216.