Antibody Information
General Information of This Antibody
| Antibody ID | ANI0TIQFA |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | BMS-986021 |
|||||
| Synonyms |
Anti-MSLN mAb 6A4; Fully human IgG1 anti-MSLN mAb 6A4
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Mesothelin (MSLN) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVHLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAQGKGLEWVASIKQAGSEKTY
VDSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAREGAYYYDSASYYPYYYYYSMDV WGQGTTVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSQYTFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
BMS-986148 [Phase 1/2 (Terminated)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
2.00% (All escalation, BMS-986148 monotherapy)
6.00% (All expansion, BMS-986148 monotherapy) 4.00% (Mesothelioma expansion, BMS-986148 monotherapy) 9.00% (Ovarian expansion) 20.00% (All, BMS-986148 + nivolumab) 23.00% (Mesothelioma, BMS-986148 + nivolumab) |
|||
| Patients Enrolled |
Pleural or peritoneal mesothelioma (except sarcomatoid mesothelioma), ovarian cancer (except mucinous carcinoma), pancreatic cancer, gastric cancer, or non-small cell lung cancer (adenocarcinoma only).
|
||||
| Administration Dosage |
BMS-986148 monotherapy (0.1-1.6 mg/kg intravenously (i.v.) every 3 weeks or 0.4 or 0.6 mg/kg i.v. once weekly; n = 96) or BMS-986148 0.8 mg/kg + nivolumab 360 mg i.v. every 3 weeks (n = 30). The primary endpoint was safety and tolerability.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02341625 | Clinical Status | Phase 1/2a | ||
| Clinical Description |
A phase 1/2a study of BMS-986148, a mesothelin directed antibody drug conjugate, in subjects with select advanced solid tumors.
|
||||
| Primary Endpoint |
The MTD and the recommended dose for the part 2 monotherapy expansion is BMS-986148 1.20 mg/kg every 3 weeks dose level. The MTD in the combination expansion cohort is BMS-986148 0.80 mg/kg + nivolumab 360 mg every 3 weeks.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT02341625 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1/2a study of BMS-986148, a mesothelin directed antibody drug conjugate, in subjects with select advanced solid tumors.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT02884726 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of the safety and tolerability of BMS 986148 in subjects with advanced and/or metastatic solid tumors.
|
||||
References
