Antigen ID	TAR0MYDAB
Antigen Name	Receptor tyrosine-protein kinase erbB-3 (ERBB3)
Gene Name	ERBB3
Gene ID	2065
Synonym	HER3; Proto-oncogene-like protein c-ErbB-3;Tyrosine kinase-type cell surface receptor HER3
Sequence	MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD SAFDNPDYWHSRLFPKANAQRT     Click to Show/Hide
Family	Tyr protein family
Function	Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.     Click to Show/Hide
Uniprot Entry	ERBB3_HUMAN
HGNC ID	HGNC:3431
KEGG ID	hsa:2065

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AMT-562	Exatecan	DNA topoisomerase 1 (TOP1)	Mc-Val-Ala-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SIBP-A13	Undisclosed	Undisclosed	Undisclosed	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Her3-ADC-07 (DAR8)	Her3-ADC-07(DAR8) payload	Undisclosed	Her3-ADC-07(DAR8) linker	[3]
ADC Info	Her3-ADC-07 (DAR4)	Her3-ADC-07(DAR4) payload	Undisclosed	Her3-ADC-07(DAR4) linker	[3]
ADC Info	Her3-ADC-07 (DAR6)	Her3-ADC-07(DAR6) payload	Undisclosed	Her3-ADC-07(DAR6) linker	[3]
ADC Info	Her3-ADC-05 (DAR4)	Her3-ADC-05(DAR4) payload	Undisclosed	Her3-ADC-05(DAR4) linker	[3]
ADC Info	Her3-ADC-15 (DAR8)	Her3-ADC-15(DAR8) payload	Undisclosed	Her3-ADC-15(DAR8) linker	[3]
ADC Info	Her3-ADC-15 (DAR2)	Her3-ADC-15(DAR2) payload	Undisclosed	Her3-ADC-15(DAR2) linker	[3]
ADC Info	Her3-ADC-21 (DAR4)	Her3-ADC-21(DAR4) payload	Undisclosed	Her3-ADC-21(DAR4) linker	[3]
ADC Info	Her3-ADC-23 (DAR4)	Her3-ADC-23(DAR4) payload	Undisclosed	Her3-ADC-23(DAR4) linker	[3]
ADC Info	Her3-ADC-33 (DAR4)	Her3-ADC-33(DAR4) payload	Undisclosed	Her3-ADC-33(DAR4) linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MMAE-9F7-F11 ADC	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Barecetamab-ADC-Tb4-1	Barecetamab-ADC-Tb4-1 payload	Undisclosed	Barecetamab-ADC-Tb4-1 linker	[3]
ADC Info	Barecetamab-ADC-Tb4-2	Barecetamab-ADC-Tb4-2 payload	Undisclosed	Barecetamab-ADC-Tb4-2 linker	[3]
ADC Info	Barecetamab-ADC-Tb4-3	Barecetamab-ADC-Tb4-3 payload	Undisclosed	Barecetamab-ADC-Tb4-3 linker	[3]
ADC Info	Barecetamab-ADC-Tb4-4	Barecetamab-ADC-Tb4-4 payload	Undisclosed	Barecetamab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CDX3379-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Duligotuzumab-ADC-Tb4-1	Duligotuzumab-ADC-Tb4-1 payload	Undisclosed	Duligotuzumab-ADC-Tb4-1 linker	[3]
ADC Info	Duligotuzumab-ADC-Tb4-2	Duligotuzumab-ADC-Tb4-2 payload	Undisclosed	Duligotuzumab-ADC-Tb4-2 linker	[3]
ADC Info	Duligotuzumab-ADC-Tb4-3	Duligotuzumab-ADC-Tb4-3 payload	Undisclosed	Duligotuzumab-ADC-Tb4-3 linker	[3]
ADC Info	Duligotuzumab-ADC-Tb4-4	Duligotuzumab-ADC-Tb4-4 payload	Undisclosed	Duligotuzumab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Elgemtumab-ADC-Tb4-1	Elgemtumab-ADC-Tb4-1 payload	Undisclosed	Elgemtumab-ADC-Tb4-1 linker	[3]
ADC Info	Elgemtumab-ADC-Tb4-2	Elgemtumab-ADC-Tb4-2 payload	Undisclosed	Elgemtumab-ADC-Tb4-2 linker	[3]
ADC Info	Elgemtumab-ADC-Tb4-3	Elgemtumab-ADC-Tb4-3 payload	Undisclosed	Elgemtumab-ADC-Tb4-3 linker	[3]
ADC Info	Elgemtumab-ADC-Tb4-4	Elgemtumab-ADC-Tb4-4 payload	Undisclosed	Elgemtumab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	EV20/MMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[6]
ADC Info	EV20/NMS-P945	NMS-P528	Human Deoxyribonucleic acid (hDNA)	Cathepsin-cleavable peptidic linker with self-immolating spacer	[7]
ADC Info	MP-EV-20	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Her3-C3-ADC-05 (DAR4)	Her3-C3-ADC-05(DAR4) payload	Undisclosed	Her3-C3-ADC-05(DAR4) linker	[3]
ADC Info	Her3-C3-ADC-21 (DAR4)	Her3-C3-ADC-21(DAR4) payload	Undisclosed	Her3-C3-ADC-21(DAR4) linker	[3]
ADC Info	Her3-C3-ADC-23 (DAR4)	Her3-C3-ADC-23(DAR4) payload	Undisclosed	Her3-C3-ADC-23(DAR4) linker	[3]
ADC Info	Her3-C3-ADC-21 (DAR8)	Her3-C3-ADC-21(DAR8) payload	Undisclosed	Her3-C3-ADC-21(DAR8) linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Lumretuzumab-ADC-Tb4-1	Lumretuzumab-ADC-Tb4-1 payload	Undisclosed	Lumretuzumab-ADC-Tb4-1 linker	[3]
ADC Info	Lumretuzumab-ADC-Tb4-2	Lumretuzumab-ADC-Tb4-2 payload	Undisclosed	Lumretuzumab-ADC-Tb4-2 linker	[3]
ADC Info	Lumretuzumab-ADC-Tb4-3	Lumretuzumab-ADC-Tb4-3 payload	Undisclosed	Lumretuzumab-ADC-Tb4-3 linker	[3]
ADC Info	Lumretuzumab-ADC-Tb4-4	Lumretuzumab-ADC-Tb4-4 payload	Undisclosed	Lumretuzumab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Patritumab deruxtecan	DX-8951 derivative (DXd)	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly	[9]
ADC Info	ADC3-6	ADC 3-6 payload	DNA topoisomerase 1 (TOP1)	ADC 3-6 linker	[10]
ADC Info	ADC3-7	ADC 3-7 payload	DNA topoisomerase 1 (TOP1)	ADC 3-7 linker	[10]
ADC Info	ADC3-8	ADC 3-8 payload	DNA topoisomerase 1 (TOP1)	ADC 3-8 linker	[10]
ADC Info	ADC3-9	ADC 3-9 payload	DNA topoisomerase 1 (TOP1)	ADC 3-9 linker	[10]
ADC Info	ADC3-10	ADC 3-10 payload	DNA topoisomerase 1 (TOP1)	ADC 3-10 linker	[10]
ADC Info	ADC3-11	ADC 3-11 payload	DNA topoisomerase 1 (TOP1)	ADC 3-11 linker	[10]
ADC Info	ADC3-12	ADC 3-12 payload	DNA topoisomerase 1 (TOP1)	ADC 3-12 linker	[10]
ADC Info	ADC3-13	ADC 3-13 payload	DNA topoisomerase 1 (TOP1)	ADC 3-13 linker	[10]
ADC Info	ADC3-14	ADC 3-14 payload	DNA topoisomerase 1 (TOP1)	ADC 3-14 linker	[10]
ADC Info	ADC3-15	ADC 3-15 payload	DNA topoisomerase 1 (TOP1)	ADC 3-15 linker	[10]
ADC Info	ADC3-16	ADC 3-16 payload	DNA topoisomerase 1 (TOP1)	ADC 3-16 linker	[10]
ADC Info	ADC3-17	ADC 3-17 payload	DNA topoisomerase 1 (TOP1)	ADC 3-17 linker	[10]
ADC Info	ADC3-18	ADC 3-18 payload	DNA topoisomerase 1 (TOP1)	ADC 3-18 linker	[10]
ADC Info	ADC3-19	ADC 3-19 payload	DNA topoisomerase 1 (TOP1)	ADC 3-19 linker	[10]
ADC Info	ADC3-20	ADC 3-20 payload	DNA topoisomerase 1 (TOP1)	ADC 3-20 linker	[10]
ADC Info	ADC-C2	ADC-C2 payload	DNA topoisomerase 1 (TOP1)	ADC-C2 linker	[10]
ADC Info	ADC-C3	ADC-C3 payload	DNA topoisomerase 1 (TOP1)	ADC-C3 linker	[10]
ADC Info	ADC-C4	ADC-C4 payload	DNA topoisomerase 1 (TOP1)	ADC-C4 linker	[10]
ADC Info	ADC-C5	ADC-C5 payload	DNA topoisomerase 1 (TOP1)	ADC-C5 linker	[10]
ADC Info	ADC-C1	ADC-C1 payload	DNA topoisomerase 1 (TOP1)	ADC-C1 linker	[10]
ADC Info	Patritumab-ADC-Tb4-1	Patritumab-ADC-Tb4-1 payload	Undisclosed	Patritumab-ADC-Tb4-1 linker	[3]
ADC Info	Patritumab-ADC-Tb4-2	Patritumab-ADC-Tb4-2 payload	Undisclosed	Patritumab-ADC-Tb4-2 linker	[3]
ADC Info	Patritumab-ADC-Tb4-3	Patritumab-ADC-Tb4-3 payload	Undisclosed	Patritumab-ADC-Tb4-3 linker	[3]
ADC Info	Patritumab-ADC-Tb4-4	Patritumab-ADC-Tb4-4 payload	Undisclosed	Patritumab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Seribantumab-ADC-Tb4-1	Seribantumab-ADC-Tb4-1 payload	Undisclosed	Seribantumab-ADC-Tb4-1 linker	[3]
ADC Info	Seribantumab-ADC-Tb4-2	Seribantumab-ADC-Tb4-2 payload	Undisclosed	Seribantumab-ADC-Tb4-2 linker	[3]
ADC Info	Seribantumab-ADC-Tb4-3	Seribantumab-ADC-Tb4-3 payload	Undisclosed	Seribantumab-ADC-Tb4-3 linker	[3]
ADC Info	Seribantumab-ADC-Tb4-4	Seribantumab-ADC-Tb4-4 payload	Undisclosed	Seribantumab-ADC-Tb4-4 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SHR-A2009	Undisclosed	Undisclosed	Undisclosed	[11]
ADC Info	MP-HER3-ADC	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[12]
ADC Info	HMBD-501	Exatecan	DNA topoisomerase 1 (TOP1)	Undisclosed	[13]
ADC Info	DB-1310	Proprietary DNA topoisomerase I inhibitor	DNA topoisomerase 1 (TOP1)	Maleimide tetrapeptide-based cleavable linker	[14]
ADC Info	HER3-ADC9 (Jiangsu Hengrui)	Undisclosed	Undisclosed	Undisclosed	[15]
ADC Info	STI-A050X	Undisclosed	Undisclosed	Undisclosed	[16]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.80E-07; Fold-change: -0.322401576; Z-score: -0.715309242
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.4075402; Fold-change: -0.195282798; Z-score: -0.755278016
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.27E-05; Fold-change: -0.844103329; Z-score: -2.427450581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.57E-08; Fold-change: -2.237221981; Z-score: -4.667713711
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.64E-76; Fold-change: -0.597811565; Z-score: -1.155941675
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.99E-07; Fold-change: 0.165461279; Z-score: 0.99624091
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.164177223; Fold-change: 0.057993732; Z-score: 0.342258485
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.386618293; Fold-change: 0.026275604; Z-score: 0.12210698
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.905178196; Fold-change: 0.003783842; Z-score: 0.03693325
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.146544693; Fold-change: -0.068901528; Z-score: -0.517089327
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.777367798; Fold-change: -0.183038638; Z-score: -0.427818213
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.139205963; Fold-change: 0.087533963; Z-score: 0.270061841
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000136754; Fold-change: -0.255089061; Z-score: -0.42909424
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.41E-07; Fold-change: 0.408304975; Z-score: 0.691336013
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.39318219; Fold-change: 0.109606213; Z-score: 0.180522631
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.785430879; Fold-change: -0.211145867; Z-score: -0.472597608
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.158076337; Fold-change: -0.035146607; Z-score: -0.08217277
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.85E-09; Fold-change: 0.212789479; Z-score: 0.678232569
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.557641599; Fold-change: 0.041029886; Z-score: 0.317633443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.21E-05; Fold-change: -0.321694755; Z-score: -0.619125272
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002969306; Fold-change: -0.145654383; Z-score: -0.30487295
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000139654; Fold-change: 1.472155713; Z-score: 1.500125799
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.84E-86; Fold-change: -0.596522932; Z-score: -1.891867884
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000840394; Fold-change: -0.711778794; Z-score: -6.584059626
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.351295896; Fold-change: 0.101303707; Z-score: 0.165085819
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002363699; Fold-change: 0.166499592; Z-score: 0.394814294
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000584153; Fold-change: 0.627265171; Z-score: 2.010820501
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.41E-06; Fold-change: 0.401921008; Z-score: 1.645091107
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.27E-06; Fold-change: -0.171146606; Z-score: -1.49659741
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.23E-21; Fold-change: -0.490721314; Z-score: -1.1831257
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.16E-09; Fold-change: 0.955970651; Z-score: 12.48256318
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.165867953; Fold-change: -0.749722161; Z-score: -0.726862856
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003475716; Fold-change: 0.516556613; Z-score: 1.872759634
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.42E-09; Fold-change: 0.934750996; Z-score: 7.213643493
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000125129; Fold-change: 0.133712954; Z-score: 0.476007924
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.979645469; Fold-change: 0.042027504; Z-score: 0.164256376
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.002364709; Fold-change: -0.097731445; Z-score: -0.863594037
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.46E-10; Fold-change: -0.1968635; Z-score: -0.660981102
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005518949; Fold-change: -0.523468084; Z-score: -1.805365916
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001575386; Fold-change: -0.482758038; Z-score: -1.956107682
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.935246539; Fold-change: -0.003316367; Z-score: -0.017512856
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.133453789; Fold-change: -0.05365248; Z-score: -0.131851316
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.422980091; Fold-change: -0.042300611; Z-score: -0.453531462
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001042452; Fold-change: -0.189572611; Z-score: -0.669644317
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.105062958; Fold-change: -0.067730966; Z-score: -0.271727241
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.577737054; Fold-change: -0.436557413; Z-score: -0.901391595
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.294698044; Fold-change: 0.03801617; Z-score: 0.155415869
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.14221503; Fold-change: 0.085777967; Z-score: 0.587382695
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009767022; Fold-change: -0.221169009; Z-score: -0.691337875
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.028938171; Fold-change: 0.026369894; Z-score: 0.232763644
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.391150881; Fold-change: 0.084550363; Z-score: 0.359289596
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016463642; Fold-change: 0.415113609; Z-score: 5.451922695
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.215504856; Fold-change: 0.225627846; Z-score: 1.003708503
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.062911669; Fold-change: -0.034639276; Z-score: -0.147733422
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079757279; Fold-change: 0.038438506; Z-score: 0.151995675
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.220859891; Fold-change: -0.018928135; Z-score: -0.18344425
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.197356696; Fold-change: 0.475290933; Z-score: 1.853125216
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.909269533; Fold-change: -0.037534412; Z-score: -0.069932936
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.110866129; Fold-change: -0.103384719; Z-score: -0.918715325
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.271988867; Fold-change: -0.21765627; Z-score: -0.507300363
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.423076831; Fold-change: 0.09172998; Z-score: 0.667810522
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.48E-06; Fold-change: -0.790016737; Z-score: -3.069241725
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.300887259; Fold-change: 0.014524841; Z-score: 0.135028731
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.315563964; Fold-change: -0.014531008; Z-score: -0.047339313
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.428575494; Fold-change: -0.104183603; Z-score: -0.184050824
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.391128078; Fold-change: -0.008172554; Z-score: -0.025197105
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.212360538; Fold-change: 0.112762024; Z-score: 0.376693945
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.019265566; Fold-change: -0.221400667; Z-score: -0.645657356
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013604765; Fold-change: -0.154784102; Z-score: -0.329278808
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.723218355; Fold-change: 0.024452521; Z-score: 0.10497088
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.736332751; Fold-change: -0.011655968; Z-score: -0.048159129
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000423311; Fold-change: -0.165882782; Z-score: -0.389774716
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.672060272; Fold-change: -0.035991699; Z-score: -0.275102962
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.255865837; Fold-change: -0.08567336; Z-score: -0.54133859
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.247520189; Fold-change: 0.148265343; Z-score: 0.504090398
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.668471875; Fold-change: 0.009659003; Z-score: 0.040686981
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.468163003; Fold-change: 0.005069775; Z-score: 0.015238151
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.18E-05; Fold-change: -0.331486187; Z-score: -0.750717775
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.92E-25; Fold-change: 0.852955476; Z-score: 1.878455719
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035894218; Fold-change: 0.418525806; Z-score: 1.122304633
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.537664845; Fold-change: -0.082781846; Z-score: -0.389754019
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.442770502; Fold-change: 0.181716135; Z-score: 0.570375176
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022267605; Fold-change: -0.248324584; Z-score: -1.428270082
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.151433417; Fold-change: 0.053539316; Z-score: 0.483495694
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.16289099; Fold-change: -0.055576177; Z-score: -0.229866292
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.02E-05; Fold-change: -0.563096132; Z-score: -4.500823082
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.457722773; Fold-change: -0.036830749; Z-score: -0.236653911
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.638026748; Fold-change: -0.088279953; Z-score: -0.698376106
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.700931979; Fold-change: -0.060801171; Z-score: -0.084681011
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007174122; Fold-change: -0.848288435; Z-score: -2.101127413
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.365937152; Fold-change: 0.136699949; Z-score: 0.562871352
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.154694558; Fold-change: -0.014190819; Z-score: -0.06341144
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001030185; Fold-change: -0.434172727; Z-score: -2.127910015
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.087020745; Fold-change: 0.10517238; Z-score: 0.778696638
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038777561; Fold-change: -0.270613501; Z-score: -0.610659743
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.053333887; Fold-change: -0.075365547; Z-score: -0.179044214
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.461625553; Fold-change: -0.095714861; Z-score: -0.336434857
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04795117; Fold-change: 0.450706063; Z-score: 1.154459123
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.945918695; Fold-change: 0.042051702; Z-score: 0.22043818
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000864162; Fold-change: 0.110835857; Z-score: 0.173478703
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.81E-29; Fold-change: 0.972896342; Z-score: 1.632726074
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.029720273; Fold-change: -0.709009952; Z-score: -1.267571875
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.49E-15; Fold-change: -0.993088233; Z-score: -1.542123896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.06703473; Fold-change: -0.138430894; Z-score: -0.383569792
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.559515928; Fold-change: -0.008971057; Z-score: -0.056132976
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.556018696; Fold-change: 0.066332397; Z-score: 1.237164472
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.146985214; Fold-change: 0.198063105; Z-score: 0.797365822
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.670580395; Fold-change: 0.095962608; Z-score: 0.374772966
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00209457; Fold-change: 0.226497225; Z-score: 1.589489561
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.423787007; Fold-change: -0.05771096; Z-score: -0.364746787
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.103120577; Fold-change: -0.289146057; Z-score: -1.325639651
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.402173647; Fold-change: -0.131929756; Z-score: -0.738353869
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.581333855; Fold-change: -0.066661849; Z-score: -0.613625797
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.570835969; Fold-change: 0.033290946; Z-score: 0.285226964
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.624191315; Fold-change: -0.100560515; Z-score: -0.233932628
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618095699; Fold-change: -0.004199947; Z-score: -0.017973221
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.091692087; Fold-change: -0.169140193; Z-score: -0.640883627
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.49517273; Fold-change: -0.063072743; Z-score: -0.235672229
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.793773274; Fold-change: 0.03444657; Z-score: 0.42306702
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006190545; Fold-change: -0.165867379; Z-score: -0.58366212
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.17537909; Fold-change: -0.110061157; Z-score: -0.302092086
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.497422023; Fold-change: 0.025549458; Z-score: 0.066367406
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387513999; Fold-change: 0.09168742; Z-score: 0.522064954
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.917148806; Fold-change: 0.003172074; Z-score: 0.006821178
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.848995004; Fold-change: 0.005784188; Z-score: 0.027093532
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024006049; Fold-change: 0.120046152; Z-score: 1.747309325
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.383643507; Fold-change: -0.016331101; Z-score: -0.03868759
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001161704; Fold-change: 0.231565306; Z-score: 0.80605852
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000551983; Fold-change: 0.473056049; Z-score: 2.600369306
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	AMT-562, a novel HER3-targeting antibody drug conjugate, demonstrates a potential to broaden therapeutic opportunities for HER3-expressing tumors. Mol Cancer Ther. 2023 Jun 11:MCT-23-0198. doi: 10.1158/1535-7163.MCT-23-0198. Online ahead of print.
Ref 2	Introduction to basic information on ADC drug SIBP-A13
Ref 3	Bioactive substance conjugate, preparation method therefor and use thereof; 2022-08-18.
Ref 4	An auristatin-based antibody-drug conjugate targeting HER3 enhances the radiation response in pancreatic cancer. Int J Cancer. 2019 Oct 1;145(7):1838-1851. doi: 10.1002/ijc.32273. Epub 2019 Apr 1.
Ref 5	Monomethyl auristatin antibody and peptide drug conjugates for trimodal cancer chemo-radio-immunotherapy. Nat Commun. 2022 Jul 5;13(1):3869. doi: 10.1038/s41467-022-31601-z.
Ref 6	EV20-mediated delivery of cytotoxic auristatin MMAF exhibits potent therapeutic efficacy in cutaneous melanoma. J Control Release. 2018 May 10;277:48-56. doi: 10.1016/j.jconrel.2018.03.016. Epub 2018 Mar 14.
Ref 7	EV20/NMS-P945, a Novel Thienoindole Based Antibody-Drug Conjugate Targeting HER-3 for Solid Tumors. Pharmaceutics. 2021 Apr 2;13(4):483. doi: 10.3390/pharmaceutics13040483.
Ref 8	Mediapharma product pipeline
Ref 9	Efficacy and Safety of Patritumab Deruxtecan (HER3-DXd) in EGFR Inhibitor-Resistant, EGFR-Mutated Non-Small Cell Lung Cancer. Cancer Discov. 2022 Jan;12(1):74-89.
Ref 10	Antibody drug conjugates; 2023-07-06.
Ref 11	A Phase I Clinical Study of SHR-A2009 for Injection in Patients With Advanced Solid Tumors; NCT05114759.
Ref 12	MP-EV20-ADC: humanized anti-HER3 antibody drug conjugate
Ref 13	HMBD-501 - a novel Fc engineered, exatecan-based next generation HER3 targeting antibody drug conjugate shows robust efficacy and tolerability in pre-clinical solid tumor models. Cancer Res (2023) 83 (7_Supplement): 2660.
Ref 14	DB-1310, a novel Her3 targeting antibody-drug conjugate, exhibits therapeutic efficacy for solid tumors. Cancer Res (2023) 83 (7_Supplement): 1884.
Ref 15	Introduction to basic information on HER3-ADC9(Jiangsu Hengrui).
Ref 16	Sorrento therapeutics next-generation cancer therapeutics; November 2013