Target Information
General Information of This Target
| Target ID | PATR0JHCHU |
|||||
|---|---|---|---|---|---|---|
| Target Name | DNA topoisomerase 2-alpha (TOP2A) |
|||||
| Gene Name | TOP2A |
|||||
| Gene ID | ||||||
| Synonym | TOP2A; TOP2; DNA topoisomerase II, alpha isozyme |
|||||
| Sequence |
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF Click to Show/Hide
|
|||||
| Family | the type II topoisomerase family |
|||||
| Function |
Key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules, generating a double-stranded break in one of the strands, passing the intact strand through the broken strand, and religating the broken strand. May play a role in regulating the period length of BMAL1 transcriptional oscillation.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Full List of The ADC Related to This Target
Phase 2 (discontinued)
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
SGN-15 |
CBR96 |
Lewis Y |
Doxorubicin |
Acid-labile linker |
Phase 1/2 (discontinued)
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
NBE-002 |
HuXBR1-402 |
ROR1 |
PNU-159682 |
LPETG-Gly5-EDA |
||
SO-N102 |
Anti-CLDN18.2 antibody |
CLDN18.2 |
PNU-159682 |
Pentaglycine-EDA uncleavable linker |
||
Milatuzumab doxorubicin |
Milatuzumab |
CD74 |
Doxorubicin |
SMCC-hydrazide |
Investigative
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
CAC10-Gly5-PNU |
Brentuximab |
Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) |
PNU-159682 |
Gly5 |
[1] | |
Tras-Gly5-EDA-Pnu |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Gly5-EDA |
[1] | |
HuXBR1-402-G5-PNU |
Anti-ROR1 mAb huXBR1-402 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
Gly5-FITC |
[2] | |
Tras-Gly5-EDA-Dox |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Doxorubicin |
Gly5-EDA |
[1] | |
Tras-Gly5-EDA-Nemo |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Nemorubicin |
Gly5-EDA |
[1] | |
Tras-Gly3-Vakl-Cit-PAB-PNU-159682 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Gly3-vcPAB |
[1] | |
Alb-DMBA-SIL-DOX |
Alb |
Albumin (ALB) |
Doxorubicin |
DMBA-SIL |
[3] | |
Trastuzumab-PNU-159682 Antibody-Drug Conjugate |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[4] | |
Trastuzumab-BCN-HydraSpace-Val-Cit-PABC-PNU-159682 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
BCN-HydraSpace-Val-Cit-PABC |
[5] | |
Trastuzumab-G5-PNU |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Gly5-FITC |
[1] | |
Anti-CD22-NMS249 |
Pinatuzumab |
B-cell receptor CD22 (CD22) |
PNU-159682 |
Mc-Val-Cit-PAB-DEA |
[6] | |
Anti-CD8-idarubicin conjugate |
Anti-CD8 (Ly-2.1) mAb |
T-cell surface glycoprotein CD8 alpha chain (CD8A); T-cell surface glycoprotein CD8 alpha chain (CD8A) |
Idarubicin |
Undisclosed |
[7] | |
MAb-DMBA-SIL-Dox |
Cetuximab |
Epidermal growth factor receptor (EGFR) |
Doxorubicin |
DMBA-SIL |
[3] | |
Cetuximab-Val-Cit-Dox |
Cetuximab |
Epidermal growth factor receptor (EGFR) |
Doxorubicin |
Mc-Val-Cit-PABC |
[8] | |
NV102 |
Undisclosed |
B-lymphocyte antigen CD19 (CD19) |
Doxorubicin |
Undisclosed |
[9] | |
NV101 |
Undisclosed |
CD99 antigen (CD99) |
Doxorubicin |
Undisclosed |
[10] | |
CytSCA208 |
CA208 |
Pregnancy-specific beta-1-glycoprotein 2 (PSG2) |
Cytorhodin S |
Undisclosed |
[11] | |
Trastuzumab-PC4AP-DOX |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Doxorubicin |
Photocaged C4AP |
[12] | |
Trastuzumab-PNUEDAGly5 |
Trastuzumab |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
LPETG-Gly5-EDA |
[13] | |
Brentuximab-PNUEDAGly5 |
Brentuximab |
Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) |
PNU-159682 |
LPETG-Gly5-EDA |
[13] | |
WO2007011968A2 cAC10-17 |
Brentuximab |
Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) |
Doxorubicin |
WO2007011968A2_cAC10-17 linker |
[14] | |
WO2007011968A2 c1F6-17 |
Anti-CD70 mAb c1F6 |
CD70 antigen (CD70) |
Doxorubicin |
WO2007011968A2_c1F6-17 linker |
[14] | |
PDL1-Dox ADC |
Atezolizumab |
Programmed cell death 1 ligand 1 (CD274) |
Doxorubicin |
Undisclosed |
[15] | |
HCD46-19 |
Anti-CD46 mAb |
Membrane cofactor protein (CD46) |
PNU-159682 |
Hydrophilic cleavable linker 19 |
[16] | |
HuIgG1-19 |
Undisclosed |
Epidermal growth factor receptor (EGFR); Receptor tyrosine-protein kinase erbB-3 (ERBB3) |
PNU-159682 |
Hydrophilic cleavable linker 19 |
[16] | |
HCD46-25 |
Anti-CD46 mAb |
Membrane cofactor protein (CD46) |
PNU-159682 |
Alternative linker without basic amines linker 25 |
[16] | |
HuIgG1-25 |
Undisclosed |
Epidermal growth factor receptor (EGFR); Receptor tyrosine-protein kinase erbB-3 (ERBB3) |
PNU-159682 |
Alternative linker without basic amines linker 25 |
[16] | |
HCD46-26 |
Anti-CD46 mAb |
Membrane cofactor protein (CD46) |
PNU-159682 |
Maleimide based noncleavable linker 26 |
[16] | |
HuIgG1-26 |
Undisclosed |
Epidermal growth factor receptor (EGFR); Receptor tyrosine-protein kinase erbB-3 (ERBB3) |
PNU-159682 |
Maleimide based noncleavable linker 26 |
[16] | |
HCD46-29 |
Anti-CD46 mAb |
Membrane cofactor protein (CD46) |
PNU-159682 |
PNU-thiazole cleavable linker 29 |
[16] | |
HuIgG1-29 |
Undisclosed |
Epidermal growth factor receptor (EGFR); Receptor tyrosine-protein kinase erbB-3 (ERBB3) |
PNU-159682 |
PNU-thiazole cleavable linker 29 |
[16] | |
B12-PEG-G2-DOX |
B12 |
Envelope glycoprotein gp160 (env) |
Cis-aconityl-doxorubicin |
B12-PEG-G2-DOX linker |
[17] | |
B12-PEG-G4-DOX |
B12 |
Envelope glycoprotein gp160 (env) |
Cis-aconityl-doxorubicin |
B12-PEG-G4-DOX linker |
[17] | |
B12-PEG-G5-DOX |
B12 |
Envelope glycoprotein gp160 (env) |
Cis-aconityl-doxorubicin |
B12-PEG-G5-DOX linker |
[17] |
Investigative(Terminated)
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
Monoclonal antibody 1H10-doxorubicin conjugate |
IH10 |
Tubulin alpha 1B (TUBA1B) |
Doxorubicin |
Dextran |
[18] | |
Anti-Laminin receptor monoclonal antibody-liposomal doxorubicin conjugate |
Anti-laminin receptor IgM |
40S ribosomal protein SA (RPSA) |
Doxorubicin |
Disulfide bond linker |
[19] |
Phase 1
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
EGFR-EDV-RRM1 |
Undisclosed |
Epidermal growth factor receptor (EGFR) |
Doxorubicin |
Undisclosed |
[20] | |
PD0721-DOX ADC |
PD0721 |
Epidermal growth factor receptor variant III (EGFRvIII) |
Doxorubicin |
dextran T-10 |
[21] | |
ZA202500202A D04-Y180/F404-LP32 |
D04-Y180/F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-L-Cysteic acid-PEG4-Gly |
[22] | |
ZA202500202A D04-F404-LP32 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-L-Cysteic acid-PEG4-Gly |
[22] | |
ZA202500202A D04-F404-LP30 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-PEG4-Gly (NH2) |
[22] | |
ZA202500202A D04-F404-LP31 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-L-Cysteic acid-PEG4 (OH) |
[22] | |
ZA202500202A D04-F404-LP24 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-PEG4 |
[22] | |
ZA202500202A D04-F404-LP25 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-PEG4-Gly |
[22] | |
ZA202500202A D04-F404-LP26 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-PEG4-EDA |
[22] | |
ZA202500202A D04-F404-LP27 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-sidechain PEG12-EDA |
[22] | |
ZA202500202A D04-F404-LP28 |
D04-F404 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-sidechain PEG12 |
[22] | |
WO2024140927A1-ADC-E (DAR6) |
mAb-A |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Doxorubicin |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[23] | |
WO2024140927A1-ADC-E (DAR2) |
mAb-A |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Doxorubicin |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[23] | |
WO2024140927A1-ADC-G (DAR2) |
mAb-D |
Vascular endothelial growth factor A (VEGFA) |
Doxorubicin |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[23] | |
WO2024140927A1-ADC-I (DAR2) |
mAb-E |
B-lymphocyte antigen CD20 (MS4A1) |
Doxorubicin |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[23] | |
WO2020252015A1 ADCLP-24 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nAA-PEG4 |
[24] | |
WO2020252015A1 ADCLP-25 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nnAA-PEG4-Gly |
[24] | |
WO2020252015A1 ADCLP-28 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-nAA-sidechain PEG12 |
[24] | |
WO2020252015A1 ADCLP-29 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-PEG4 |
[24] | |
WO2020252015A1 ADCLP-30 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-PEG4-Gly (OH) |
[24] | |
WO2020252015A1 ADCLP-31 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-L-Cysteic acid-PEG4 (OH) |
[24] | |
WO2020252015A1 ADCLP-32 |
mAb42 |
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
PNU-159682 |
DBCO-L-Cysteic acid-PEG4-Gly |
[24] | |
CN106714844B ADC-101 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-101-linker |
[25] | |
CN106714844B ADC-102 |
10F4v3 HC A118C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-103 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-103-linker |
[25] | |
CN106714844B ADC-104 |
10F4v3 HC A118C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-105 |
GM15.33 HC A118C |
Myeloid cell surface antigen CD33 (CD33) |
PNU-159682 |
CN106714844B-ADC-105-linker |
[25] | |
CN106714844B ADC-106 |
10H1.11B HC A118C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-107 |
7C2 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-108 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-109 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-109-linker |
[25] | |
CN106714844B ADC-110 |
15G15.3 LC K149C |
Myeloid cell surface antigen CD33 (CD33) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-111 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-112 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-113 |
10H1.11B HC A118C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-114 |
7C2 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-115 |
15G15.3 LC K149C |
Myeloid cell surface antigen CD33 (CD33) |
PNU-159682 |
CN106714844B-ADC-115-linker |
[25] | |
CN106714844B ADC-116 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-117 |
6E7.N54A LC K149C |
C-type lectin domain family 12 member A (CLEC12A) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-118 |
6E7.N54A LC K149C |
C-type lectin domain family 12 member A (CLEC12A) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-119 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-119-linker |
[25] | |
CN106714844B ADC-120 |
10F4v3 LC A149C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-121 |
10H1.11.4B LC A149C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-122 |
10F4v3 LC A149C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-123 |
10H1.11.4B LC A149C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-124 |
10F4v3 LC A149C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
CN106714844B-ADC-124-linker |
[25] | |
CN106714844B ADC-125 |
10H1.11.4B LC A149C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-126 |
10F4v3 LC A149C |
B-cell receptor CD22 (CD22) |
PNU-159682 |
CN106714844B-ADC-126-linker |
[25] | |
CN106714844B ADC-127 |
10H1.11.4B LC A149C |
Sodium-dependent phosphate transport protein 2B (SLC34A2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-128 |
4D5 HC A140C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-129 |
4D5 LC A149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-130 |
4D5 LC V205C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-131 |
4D5 HC A118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-132 |
4D5 LC S121C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-133 |
6E7.N54A LC K149C |
C-type lectin domain family 12 member A (CLEC12A) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-134 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-134-linker |
[25] | |
CN106714844B ADC-135 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
CN106714844B-ADC-135-linker |
[25] | |
CN106714844B ADC-136 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Undisclosed |
[25] | |
CN106714844B ADC-137 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Ethylmaleimide linker |
[25] | |
CN106714844B ADC-138 |
7C2 LC K149C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Ethylmaleimide linker |
[25] | |
CN106714844B ADC-139 |
15G15.3 LC K149C |
Myeloid cell surface antigen CD33 (CD33) |
PNU-159682 |
Ethylmaleimide linker |
[25] | |
CN106714844B ADC-140 |
7C2 HC K118C |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PNU-159682 |
Ethylmaleimide linker |
[25] | |
CN113286618A ADC-1 |
alpha-HMGB1Ab |
High mobility group box 1 protein (HMGB1) |
Doxorubicin |
CN113286618A-ADC-1-linker |
[26] | |
CN113286618A ADC-2 |
alpha-KLHAb |
Hemocyanin 1 (KLH1) |
Doxorubicin |
Undisclosed |
[26] | |
CN114450324B ADC-39 |
undisclosed |
Interleukin-1 beta (IL1B) |
Doxorubicin |
CN114450324B-ADC-39-linker |
[27] | |
CN114450324B ADC-41 |
undisclosed |
Interleukin-1 beta (IL1B) |
Doxorubicin |
CN114450324B-ADC-41-linker |
[27] | |
PNU-159682-P1C1TM |
undisclosed |
Cellular tumor antigen p53 (TP53) |
PNU-159682 |
Undisclosed |
References
