Antigen ID	TAR0XTCGM
Antigen Name	B-cell receptor CD22 (CD22)
Gene Name	CD22
Gene ID	933
Synonym	B-lymphocyte cell adhesion molecule;Sialic acid-binding Ig-like lectin 2;T-cell surface antigen Leu-14;CD_antigen=CD22
Sequence	MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV DYVILKH     Click to Show/Hide
Family	LISCH7 family
Function	Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6- linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.     Click to Show/Hide
Uniprot Entry	CD22_HUMAN
HGNC ID	HGNC:1643
KEGG ID	hsa:933

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD22-SN36248	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD22-SPDB-DM4	Mertansine DM4	Microtubule (MT)	N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)	[2]
ADC Info	Anti-CD22-K149C-MBT-DM4	Mertansine DM4	Microtubule (MT)	MBT	[2]
ADC Info	Anti-CD22-K149C-MPEO-DM1	Mertansine DM1	Microtubule (MT)	MPEO	[2]
ADC Info	Anti-CD22-K149C-DM1	Mertansine DM1	Microtubule (MT)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AbBJ-ConjA	AbBJ-ConjA payload	Undisclosed	AbBJ-ConjA linker	[3]
ADC Info	AbBJ-ConjB	AbBJ-ConjB payload	Undisclosed	AbBJ-ConjB linker	[3]
ADC Info	AbBJ-ConjC	AbBJ-ConjC payload	Undisclosed	AbBJ-ConjC linker	[3]
ADC Info	AbBJ-ConjD	AbBJ-ConjD payload	Undisclosed	AbBJ-ConjD linker	[3]
ADC Info	AbBJ-ConjE	AbBJ-ConjE payload	Undisclosed	AbBJ-ConjE linker	[3]
ADC Info	AbBJ-ConjF	AbBJ-ConjF payload	Undisclosed	AbBJ-ConjF linker	[3]
ADC Info	AbBJ-ConjG	AbBJ-ConjG payload	Undisclosed	AbBJ-ConjG linker	[3]
ADC Info	AbBJ-ConjH	AbBJ-ConjH payload	Undisclosed	AbBJ-ConjH linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AbCJX-ConjA	AbCJX-ConjA payload	Undisclosed	AbCJX-ConjA linker	[3]
ADC Info	AbCJX-ConjB	AbCJX-ConjB payload	Undisclosed	AbCJX-ConjB linker	[3]
ADC Info	AbCJX-ConjC	AbCJX-ConjC payload	Undisclosed	AbCJX-ConjC linker	[3]
ADC Info	AbCJX-ConjD	AbCJX-ConjD payload	Undisclosed	AbCJX-ConjD linker	[3]
ADC Info	AbCJX-ConjE	AbCJX-ConjE payload	Undisclosed	AbCJX-ConjE linker	[3]
ADC Info	AbCJX-ConjF	AbCJX-ConjF payload	Undisclosed	AbCJX-ConjF linker	[3]
ADC Info	AbCJX-ConjG	AbCJX-ConjG payload	Undisclosed	AbCJX-ConjG linker	[3]
ADC Info	AbCJX-ConjH	AbCJX-ConjH payload	Undisclosed	AbCJX-ConjH linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AbDJ-ConjA	AbDJ-ConjA payload	Undisclosed	AbDJ-ConjA linker	[3]
ADC Info	AbDJ-ConjB	AbDJ-ConjB payload	Undisclosed	AbDJ-ConjB linker	[3]
ADC Info	AbDJ-ConjC	AbDJ-ConjC payload	Undisclosed	AbDJ-ConjC linker	[3]
ADC Info	AbDJ-ConjD	AbDJ-ConjD payload	Undisclosed	AbDJ-ConjD linker	[3]
ADC Info	AbDJ-ConjE	AbDJ-ConjE payload	Undisclosed	AbDJ-ConjE linker	[3]
ADC Info	AbDJ-ConjF	AbDJ-ConjF payload	Undisclosed	AbDJ-ConjF linker	[3]
ADC Info	AbDJ-ConjG	AbDJ-ConjG payload	Undisclosed	AbDJ-ConjG linker	[3]
ADC Info	AbDJ-ConjH	AbDJ-ConjH payload	Undisclosed	AbDJ-ConjH linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AbHJ-ConjA	AbHJ-ConjA payload	Undisclosed	AbHJ-ConjA linker	[3]
ADC Info	AbHJ-ConjB	AbHJ-ConjB payload	Undisclosed	AbHJ-ConjB linker	[3]
ADC Info	AbHJ-ConjC	AbHJ-ConjC payload	Undisclosed	AbHJ-ConjC linker	[3]
ADC Info	AbHJ-ConjD	AbHJ-ConjD payload	Undisclosed	AbHJ-ConjD linker	[3]
ADC Info	AbHJ-ConjE	AbHJ-ConjE payload	Undisclosed	AbHJ-ConjE linker	[3]
ADC Info	AbHJ-ConjF	AbHJ-ConjF payload	Undisclosed	AbHJ-ConjF linker	[3]
ADC Info	AbHJ-ConjG	AbHJ-ConjG payload	Undisclosed	AbHJ-ConjG linker	[3]
ADC Info	AbHJ-ConjH	AbHJ-ConjH payload	Undisclosed	AbHJ-ConjH linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AbLJ-ConjA	AbLJ-ConjA payload	Undisclosed	AbLJ-ConjA linker	[3]
ADC Info	AbLJ-ConjB	AbLJ-ConjB payload	Undisclosed	AbLJ-ConjB linker	[3]
ADC Info	AbLJ-ConjC	AbLJ-ConjC payload	Undisclosed	AbLJ-ConjC linker	[3]
ADC Info	AbLJ-ConjD	AbLJ-ConjD payload	Undisclosed	AbLJ-ConjD linker	[3]
ADC Info	AbLJ-ConjE	AbLJ-ConjE payload	Undisclosed	AbLJ-ConjE linker	[3]
ADC Info	AbLJ-ConjF	AbLJ-ConjF payload	Undisclosed	AbLJ-ConjF linker	[3]
ADC Info	AbLJ-ConjG	AbLJ-ConjG payload	Undisclosed	AbLJ-ConjG linker	[3]
ADC Info	AbLJ-ConjH	AbLJ-ConjH payload	Undisclosed	AbLJ-ConjH linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HB22.7-SAP	Saporin	Microtubule (MT)	Undisclosed	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2013055987A1 xCD22-103	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2013055987A1_xCD22-103 linker	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD22-HC-A140C-10	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-peptidomimetic based linker 10	[6]
ADC Info	Alpha-CD22-HC-A140C-11	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-PEG2	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ACD22-LC-K149C-10	PA-seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-cBu-Cit	[7]
ADC Info	Alpha-CD22-LC-K149C-10	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-peptidomimetic based linker 10	[6]
ADC Info	Alpha-CD22-LC-K149C-11	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2	[6]
ADC Info	Alpha-CD22-LC-K149C-12	Seco-CBI-dimer 12	Human Deoxyribonucleic acid (hDNA)	Mc-peptidomimetic based linker 12	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD22-LC-V205C-10	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-peptidomimetic based linker 10	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-101	CN105828840B_ADC-101 payload	Undisclosed	CN105828840B_ADC-101 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-104	CN105828840B_ADC-104 payload	Undisclosed	CN105828840B_ADC-104 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-108	CN105828840B_ADC-108 payload	Undisclosed	CN105828840B_ADC-108 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-110	CN105828840B_ADC-110 payload	Undisclosed	CN105828840B_ADC-110 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-111	CN105828840B_ADC-111 payload	Undisclosed	CN105828840B_ADC-111 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-115	CN105828840B_ADC-115 payload	Undisclosed	CN105828840B_ADC-115 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-116	CN105828840B_ADC-116 payload	Undisclosed	CN105828840B_ADC-116 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-120	CN105828840B_ADC-120 payload	Undisclosed	CN105828840B_ADC-120 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-122	CN105828840B_ADC-122 payload	Undisclosed	CN105828840B_ADC-122 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-124	CN105828840B_ADC-124 payload	Undisclosed	CN105828840B_ADC-124 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ADCT-602	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[9]
ADC Info	Epratuzumab-SN38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[10]
ADC Info	BAY-1862864	Undisclosed	Undisclosed	Undisclosed	[11]
ADC Info	RNAse monoclonal antibody-LL2-I-131-conjugate	Undisclosed	Undisclosed	Undisclosed	[12]
ADC Info	Emab-CL2E-SN38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2E	[13]
ADC Info	HLL2-PBD	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[14]
ADC Info	Epratuzumab-CL2E-SN-38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2E	[15]
ADC Info	Epratuzumab-SN-38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[15]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Inotuzumab ozogamicin	N-acetyl-gamma-calicheamicin	Human Deoxyribonucleic acid (hDNA)	AcButDMH	[16]
ADC Info	Inotuzumab-ADC-24-1	Inotuzumab-ADC-24-1 payload	Undisclosed	Inotuzumab-ADC-24-1 linker	[17]
ADC Info	Inotuzumab-ADC-24-2	Inotuzumab-ADC-24-2 payload	Undisclosed	Inotuzumab-ADC-24-2 linker	[17]
ADC Info	Inotuzumab-ADC-24-3	Inotuzumab-ADC-24-3 payload	Undisclosed	Inotuzumab-ADC-24-3 linker	[17]
ADC Info	Inotuzumab-ADC-24-4	Inotuzumab-ADC-24-4 payload	Undisclosed	Inotuzumab-ADC-24-4 linker	[17]
ADC Info	Inotuzumab-ADC-24-5	Inotuzumab-ADC-24-5 payload	Undisclosed	Inotuzumab-ADC-24-5 linker	[17]
ADC Info	Inotuzumab-ADC-24-6	Inotuzumab-ADC-24-6 payload	Undisclosed	Inotuzumab-ADC-24-6 linker	[17]
ADC Info	Inotuzumab-ADC-24-7	Inotuzumab-ADC-24-7 payload	Undisclosed	Inotuzumab-ADC-24-7 linker	[17]
ADC Info	Inotuzumab-ADC-24-8	Inotuzumab-ADC-24-8 payload	Undisclosed	Inotuzumab-ADC-24-8 linker	[17]
ADC Info	Inotuzumab-ADC-24-9	Inotuzumab-ADC-24-9 payload	Undisclosed	Inotuzumab-ADC-24-9 linker	[17]
ADC Info	Inotuzumab-ADC-24-10	Inotuzumab-ADC-24-10 payload	Undisclosed	Inotuzumab-ADC-24-10 linker	[17]
ADC Info	Inotuzumab-ADC-24-11	Inotuzumab-ADC-24-11 payload	Undisclosed	Inotuzumab-ADC-24-11 linker	[17]
ADC Info	Inotuzumab-ADC-24-12	Inotuzumab-ADC-24-12 payload	Undisclosed	Inotuzumab-ADC-24-12 linker	[17]
ADC Info	Inotuzumab-ADC-24-13	Inotuzumab-ADC-24-13 payload	Undisclosed	Inotuzumab-ADC-24-13 linker	[17]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Moxetumomab pasudotox	Pseudomonas exotoxin PE38	Eukaryotic elongation factor 2 (EEF2)	Mc-Val-Cit-PABC	[18]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD22- (LC:K149C)-SN36248	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2	[1]
ADC Info	Anti-CD22-NMS249	PNU-159682	DNA topoisomerase 2-alpha (TOP2A)	Mc-Val-Cit-PAB-DEA	[19]
ADC Info	Pinatuzumab-ADC-24-1	Pinatuzumab-ADC-24-1 payload	Undisclosed	Pinatuzumab-ADC-24-1 linker	[17]
ADC Info	Pinatuzumab-ADC-24-2	Pinatuzumab-ADC-24-2 payload	Undisclosed	Pinatuzumab-ADC-24-2 linker	[17]
ADC Info	Pinatuzumab-ADC-24-3	Pinatuzumab-ADC-24-3 payload	Undisclosed	Pinatuzumab-ADC-24-3 linker	[17]
ADC Info	Pinatuzumab-ADC-24-4	Pinatuzumab-ADC-24-4 payload	Undisclosed	Pinatuzumab-ADC-24-4 linker	[17]
ADC Info	Pinatuzumab-ADC-24-5	Pinatuzumab-ADC-24-5 payload	Undisclosed	Pinatuzumab-ADC-24-5 linker	[17]
ADC Info	Pinatuzumab-ADC-24-6	Pinatuzumab-ADC-24-6 payload	Undisclosed	Pinatuzumab-ADC-24-6 linker	[17]
ADC Info	Pinatuzumab-ADC-24-7	Pinatuzumab-ADC-24-7 payload	Undisclosed	Pinatuzumab-ADC-24-7 linker	[17]
ADC Info	Pinatuzumab-ADC-24-8	Pinatuzumab-ADC-24-8 payload	Undisclosed	Pinatuzumab-ADC-24-8 linker	[17]
ADC Info	Pinatuzumab-ADC-24-9	Pinatuzumab-ADC-24-9 payload	Undisclosed	Pinatuzumab-ADC-24-9 linker	[17]
ADC Info	Pinatuzumab-ADC-24-10	Pinatuzumab-ADC-24-10 payload	Undisclosed	Pinatuzumab-ADC-24-10 linker	[17]
ADC Info	Pinatuzumab-ADC-24-11	Pinatuzumab-ADC-24-11 payload	Undisclosed	Pinatuzumab-ADC-24-11 linker	[17]
ADC Info	Pinatuzumab-ADC-24-12	Pinatuzumab-ADC-24-12 payload	Undisclosed	Pinatuzumab-ADC-24-12 linker	[17]
ADC Info	Pinatuzumab-ADC-24-13	Pinatuzumab-ADC-24-13 payload	Undisclosed	Pinatuzumab-ADC-24-13 linker	[17]
ADC Info	Pinatuzumab vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[20]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RFB4-SMPT-dgA	Deglycosylated ricin A-chain (dgA)	Undisclosed	Succynimidyloxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio) toluene (SMPT)	[21]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017214024A1 ADC-101	WO2017214024A1_ADC-101 payload	Undisclosed	WO2017214024A1_ADC-101 linker	[22]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-116	WO2017059289A1_ADC-116 payload	Undisclosed	WO2017059289A1_ADC-116 linker	[23]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-202	WO2017059289A1_ADC-202 payload	Undisclosed	WO2017059289A1_ADC-202 linker	[23]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2014159981A2 ADC-115	WO2014159981A2_ADC-115 payload	Undisclosed	WO2014159981A2_ADC-115 linker	[24]
ADC Info	WO2014159981A2 ADC-125	WO2014159981A2_ADC-125 payload	Undisclosed	WO2014159981A2_ADC-125 linker	[24]
ADC Info	WO2014159981A2 ADC-212	WO2014159981A2_ADC-212 payload	Undisclosed	WO2014159981A2_ADC-212 linker	[24]
ADC Info	WO2014159981A2 ADC-135	WO2014159981A2_ADC-135 payload	Undisclosed	WO2014159981A2_ADC-135 linker	[24]
ADC Info	WO2014159981A2 ADC-CD22-44	WO2014159981A2_ADC-CD22-44 payload	Undisclosed	WO2014159981A2_ADC-CD22-44 linker	[24]
ADC Info	WO2014159981A2 ADC-CD22-48	WO2014159981A2_ADC-CD22-48 payload	Undisclosed	WO2014159981A2_ADC-CD22-48 linker	[24]
ADC Info	WO2014159981A2 ADC-CD22-22	WO2014159981A2_ADC-CD22-22 payload	Undisclosed	WO2014159981A2_ADC-CD22-22 linker	[24]
ADC Info	WO2014159981A2 ADC-CD22-41	WO2014159981A2_ADC-CD22-41 payload	Undisclosed	WO2014159981A2_ADC-CD22-41 linker	[24]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017214024A1 ADC-105	WO2017214024A1_ADC-105 payload	Undisclosed	WO2017214024A1_ADC-105 linker	[22]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-118	WO2017059289A1_ADC-118 payload	Undisclosed	WO2017059289A1_ADC-118 linker	[23]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-103	WO2017059289A1_ADC-103 payload	Undisclosed	WO2017059289A1_ADC-103 linker	[23]
ADC Info	WO2017059289A1 ADC-105	WO2017059289A1_ADC-105 payload	Undisclosed	WO2017059289A1_ADC-105 linker	[23]
ADC Info	WO2017059289A1 ADC-107	WO2017059289A1_ADC-107 payload	Undisclosed	WO2017059289A1_ADC-107 linker	[23]
ADC Info	WO2017059289A1 ADC-110	WO2017059289A1_ADC-110 payload	Undisclosed	WO2017059289A1_ADC-110 linker	[23]
ADC Info	WO2017059289A1 ADC-204	WO2017059289A1_ADC-204 payload	Undisclosed	WO2017059289A1_ADC-204 linker	[23]
ADC Info	WO2017059289A1 ADC-206	WO2017059289A1_ADC-206 payload	Undisclosed	WO2017059289A1_ADC-206 linker	[23]
ADC Info	WO2017059289A1 ADC-207	WO2017059289A1_ADC-207 payload	Undisclosed	WO2017059289A1_ADC-207 linker	[23]
ADC Info	WO2017214024A1 ADC-104	WO2017214024A1_ADC-104 payload	Undisclosed	WO2017214024A1_ADC-104 linker	[22]
ADC Info	WO2017214024A1 ADC-108	WO2017214024A1_ADC-108 payload	Undisclosed	WO2017214024A1_ADC-108 linker	[22]
ADC Info	WO2017214024A1 ADC-110	WO2017214024A1_ADC-110 payload	Undisclosed	WO2017214024A1_ADC-110 linker	[22]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-111	WO2017059289A1_ADC-111 payload	Undisclosed	WO2017059289A1_ADC-111 linker	[23]
ADC Info	WO2017059289A1 ADC-112	WO2017059289A1_ADC-112 payload	Undisclosed	WO2017059289A1_ADC-112 linker	[23]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	TAC-001	Differentiated TLR-9 agonist (T-CpG)	Toll-like receptor 9 (TLR9)	Undisclosed	[25]
ADC Info	TRPH-222	Maytansinoid	Microtubule (MT)	Undisclosed	[26]
ADC Info	Anti-CD22 antibody drug-conjugate (Medarex/BMS)	Undisclosed	Undisclosed	Undisclosed	[27]
ADC Info	Anti-CD22 antibody-drug conjugate (Ambrx)	Undisclosed	Undisclosed	Undisclosed	[28]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.63E-15; Fold-change: 0.324121092; Z-score: 1.331251827
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014132974; Fold-change: -1.578440596; Z-score: -9.55296882
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001195006; Fold-change: -1.024981823; Z-score: -1.751946496
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.82E-09; Fold-change: -1.576291081; Z-score: -6.723357581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.30E-103; Fold-change: -1.281366451; Z-score: -1.585343532
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.24E-09; Fold-change: -0.3893891; Z-score: -1.680620845
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.97E-05; Fold-change: -0.489015375; Z-score: -1.722154604
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.26E-09; Fold-change: -0.560977873; Z-score: -1.474118472
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.101552992; Fold-change: -1.055350327; Z-score: -1.435793957
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.598292491; Fold-change: 0.137048949; Z-score: 0.286507434
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.167478653; Fold-change: -0.617420844; Z-score: -1.829445511
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.04050186; Fold-change: -0.328644753; Z-score: -0.476074428
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.80E-18; Fold-change: -0.346869264; Z-score: -0.665076181
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.57E-15; Fold-change: -0.289591363; Z-score: -0.665445097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.075084502; Fold-change: -0.240903304; Z-score: -0.266041872
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.48E-06; Fold-change: -0.438459529; Z-score: -0.555935616
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000458833; Fold-change: -0.128039161; Z-score: -0.656402195
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.83E-11; Fold-change: -0.135463058; Z-score: -0.619536876
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.317188099; Fold-change: -0.234331697; Z-score: -0.656689652
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-17; Fold-change: -0.282766326; Z-score: -0.762158311
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.28E-15; Fold-change: -0.305994004; Z-score: -0.884042103
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.68E-05; Fold-change: 0.382077492; Z-score: 0.968848072
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.27E-16; Fold-change: -0.236036021; Z-score: -0.723641984
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.023017722; Fold-change: -0.441776735; Z-score: -3.001987792
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.17E-10; Fold-change: 0.134511935; Z-score: 0.41268807
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.133675931; Fold-change: 0.076366668; Z-score: 0.19777896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.61E-05; Fold-change: -2.583685935; Z-score: -3.529089248
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.491482319; Fold-change: -0.116233775; Z-score: -0.247384118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.542631949; Fold-change: 0.073738656; Z-score: 0.280461132
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.35E-09; Fold-change: 0.208751578; Z-score: 0.741593929
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.063864511; Fold-change: -0.16583691; Z-score: -0.975646774
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.924623156; Fold-change: 0.142971001; Z-score: 0.190276696
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.55748764; Fold-change: -0.050021237; Z-score: -0.187113607
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.719384018; Fold-change: -9.59E-05; Z-score: -0.001035094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.099621021; Fold-change: 0.125571268; Z-score: 0.126003528
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000217147; Fold-change: 0.522049054; Z-score: 0.637037059
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.390962545; Fold-change: -0.291079496; Z-score: -0.662902372
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.117560111; Fold-change: 0.057835292; Z-score: 0.064501781
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.08713732; Fold-change: 0.174074757; Z-score: 1.04846669
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000382027; Fold-change: 0.253658449; Z-score: 1.589521123
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.69048606; Fold-change: 0.675894133; Z-score: 0.44493011
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.152285462; Fold-change: -0.092424955; Z-score: -0.074202707
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.519425825; Fold-change: 0.115577372; Z-score: 0.86827976
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.02E-09; Fold-change: -0.620049282; Z-score: -1.297382947
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.557805406; Fold-change: -0.016194209; Z-score: -0.042198067
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.096368559; Fold-change: -0.148873039; Z-score: -0.744976572
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.454123466; Fold-change: -0.187611254; Z-score: -0.429690137
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.351993043; Fold-change: 0.286822239; Z-score: 2.322835104
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.15E-10; Fold-change: -0.966139087; Z-score: -1.917007686
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.892896922; Fold-change: -0.103684962; Z-score: -0.149475872
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.389617545; Fold-change: 0.355426889; Z-score: 0.4081668
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035624774; Fold-change: 0.261540542; Z-score: 2.006498399
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.537478523; Fold-change: 0.013364507; Z-score: 0.054593223
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.98E-07; Fold-change: -0.85483905; Z-score: -1.162066597
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.75E-31; Fold-change: -0.745273964; Z-score: -1.367466117
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004382864; Fold-change: -0.512112546; Z-score: -0.909155196
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.30324301; Fold-change: -0.11201689; Z-score: -0.502772557
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.195344505; Fold-change: -0.185263493; Z-score: -0.254222575
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.151022523; Fold-change: -0.258463149; Z-score: -0.666672909
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.963231054; Fold-change: -0.059155648; Z-score: -0.162002621
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.112244314; Fold-change: 0.165733669; Z-score: 0.599715918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.171014457; Fold-change: 0.089143313; Z-score: 0.309628531
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.248274413; Fold-change: 0.074791057; Z-score: 0.570220459
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.224662378; Fold-change: 0.686475785; Z-score: 4.858888285
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021088938; Fold-change: 0.288338163; Z-score: 2.098009064
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.773004585; Fold-change: 0.030295802; Z-score: 0.291316683
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.234702263; Fold-change: -0.020272862; Z-score: -0.07418088
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000197778; Fold-change: 0.214634078; Z-score: 0.806897034
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.558373568; Fold-change: -0.020194019; Z-score: -0.064371631
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.599293673; Fold-change: -0.052142261; Z-score: -0.487903543
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.44E-05; Fold-change: 0.432646922; Z-score: 5.218334892
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.74E-12; Fold-change: 0.295838282; Z-score: 1.118095993
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.044731656; Fold-change: 0.114279743; Z-score: 0.932177197
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.40E-05; Fold-change: 0.540398212; Z-score: 3.343738473
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001448742; Fold-change: 0.359238384; Z-score: 1.233335108
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200205992; Fold-change: 0.04994636; Z-score: 0.077442051
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.679542645; Fold-change: -0.017122442; Z-score: -0.131474548
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013154763; Fold-change: -0.210298101; Z-score: -0.646304127
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.02E-21; Fold-change: 0.271282447; Z-score: 1.454467825
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.254434626; Fold-change: -0.086635319; Z-score: -0.8140312
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010365552; Fold-change: 0.074227608; Z-score: 0.261156528
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.21059204; Fold-change: -0.083078099; Z-score: -0.736637111
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.159872158; Fold-change: -0.276780885; Z-score: -0.692690657
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.370274148; Fold-change: -0.272280385; Z-score: -0.684289404
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.61E-07; Fold-change: -0.740385402; Z-score: -1.085507609
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007284588; Fold-change: -0.575905418; Z-score: -1.736650742
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046600225; Fold-change: 0.196516089; Z-score: 0.439312397
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.544670802; Fold-change: 0.027909739; Z-score: 0.517252474
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010461027; Fold-change: 0.149512828; Z-score: 0.497614312
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000998895; Fold-change: 0.700684881; Z-score: 4.148670453
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200999031; Fold-change: 0.197197528; Z-score: 1.203362135
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.89E-11; Fold-change: -0.210620126; Z-score: -0.576256135
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.995792669; Fold-change: 0.054991716; Z-score: 0.271336217
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.220643496; Fold-change: -0.000869259; Z-score: -0.007565259
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008894136; Fold-change: -0.305366511; Z-score: -0.41826501
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.932691817; Fold-change: 0.047405525; Z-score: 0.139682262
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.011681289; Fold-change: -0.143361739; Z-score: -2.05199215
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.115982058; Fold-change: -0.192461338; Z-score: -0.605027974
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.009833871; Fold-change: -0.362829314; Z-score: -1.275355221
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.16E-11; Fold-change: 0.05329432; Z-score: 0.140194058
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.37E-57; Fold-change: 0.657102779; Z-score: 2.865769141
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002696093; Fold-change: -0.385599763; Z-score: -1.813905263
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.82E-07; Fold-change: -0.247443928; Z-score: -1.08744492
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.715898176; Fold-change: 0.018574313; Z-score: 0.0717893
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.30157735; Fold-change: 0.080343795; Z-score: 0.870109979
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.589735221; Fold-change: -0.130642366; Z-score: -0.461822372
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011678271; Fold-change: -1.038480842; Z-score: -1.409852029
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.954003403; Fold-change: -0.076170795; Z-score: -0.358847672
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.796288098; Fold-change: 0.043568598; Z-score: 0.153472357
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000220918; Fold-change: -1.53414554; Z-score: -2.442130261
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257128681; Fold-change: 0.530560403; Z-score: 2.037323377
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.087649725; Fold-change: -0.09372665; Z-score: -0.547240468
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.187538405; Fold-change: -0.348626515; Z-score: -0.593534243
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013870954; Fold-change: -0.232051565; Z-score: -1.734945308
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.05682211; Fold-change: -0.289123252; Z-score: -1.427031917
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.217640656; Fold-change: -0.061729435; Z-score: -0.424241809
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.937998447; Fold-change: -0.029298665; Z-score: -0.183315985
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.617677672; Fold-change: -0.00148253; Z-score: -0.010824235
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.972696587; Fold-change: 0.326518524; Z-score: 0.572466414
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.057236963; Fold-change: -0.149085126; Z-score: -0.33607489
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.047166228; Fold-change: -0.202223866; Z-score: -0.389533126
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.068536064; Fold-change: 0.204942422; Z-score: 0.439248948
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.960746065; Fold-change: -0.029189131; Z-score: -0.0628178
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00011918; Fold-change: 0.382905267; Z-score: 0.517775407
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.798187648; Fold-change: 0.111755665; Z-score: 0.128821752
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.281952262; Fold-change: -0.033198721; Z-score: -0.855679488
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.512320634; Fold-change: -0.052227862; Z-score: -0.328999621
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000591328; Fold-change: -0.32996056; Z-score: -1.371461848
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012860359; Fold-change: -0.202296893; Z-score: -2.097795202
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	An Anti-CD22-seco-CBI-Dimer Antibody-Drug Conjugate (ADC) for the Treatment of Non-Hodgkin Lymphoma That Provides a Longer Duration of Response than Auristatin-Based ADCs in Preclinical Models. Mol Cancer Ther. 2021 Feb;20(2):340-346.
Ref 2	Decoupling stability and release in disulfide bonds with antibody-small molecule conjugates. Chem Sci. 2017 Jan 1;8(1):366-370. doi: 10.1039/c6sc01831a. Epub 2016 Aug 22.
Ref 3	Heteroarylene-bridged benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 4	The HB22.7 Anti-CD22 Monoclonal Antibody Is an Effective Platform for CD22-Targeted Antibody Drug Conjugates for Treatment of Lymphoma and Acute Lymphoblastic Leukemia. Blood. 2012 ;120(21):-. doi: 10.1182/blood.V120.21.1653.1653.
Ref 5	Pyrrolobenzodiazepines and conjugates thereof; 2013-04-18.
Ref 6	Antibody-Drug Conjugates Derived from Cytotoxic seco-CBI-Dimer Payloads Are Highly Efficacious in Xenograft Models and Form Protein Adducts In Vivo. Bioconjug Chem. 2019 May 15;30(5):1356-1370. doi: 10.1021/acs.bioconjchem.9b00133. Epub 2019 Apr 22.
Ref 7	Antibody-Drug Conjugates Derived from Cytotoxic seco-CBI-Dimer Payloads Are Highly Efficacious in Xenograft Models and Form Protein Adducts In Vivo. Bioconjug Chem. 2019 May 15;30(5):1356-1370. doi: 10.1021/acs.bioconjchem.9b00133. Epub 2019 Apr 22.
Ref 8	1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment.
Ref 9	A Phase 1 Trial of Adct-602, a CD22 Targeting Antibody Drug Conjugate Bound to PBD Toxin in Adult Patients with Relapsed or Refractory CD22+B-Cell Acute Lymphoblastic Leukemia. Blood. 2021 ;138():-. doi: 10.1182/blood-2021-153141.
Ref 10	ADC review: basic information about Epratuzumab-SN-38.
Ref 11	227Th-Labeled Anti-CD22 Antibody (BAY 1862864) in Relapsed/Refractory CD22-Positive Non-Hodgkin Lymphoma: A First-in-Human, Phase I Study. Cancer Biother Radiopharm. 2021 Oct;36(8):672-681. doi: 10.1089/cbr.2020.4653.
Ref 12	Potent and specific antitumor effects of an anti-CD22-targeted cytotoxic ribonuclease: potential for the treatment of non-Hodgkin lymphoma. Blood. 2001 Jan 15;97(2):528-35. doi: 10.1182/blood.v97.2.528.
Ref 13	Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34.
Ref 14	Preclinical activity of hLL2-PBD, a novel anti-CD22 antibody-pyrrolobenzodiazepine (PBD) conjugate in models of non-Hodgkin lymphoma. Cancer Res (2015) 75 (15_Supplement): 637.
Ref 15	Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34. doi: 10.1158/1535-7163.MCT-11-0632. Epub 2011 Oct 28.
Ref 16	Inotuzumab Ozogamicin versus Standard Therapy for Acute Lymphoblastic Leukemia. N Engl J Med. 2016 Aug 25;375(8):740-53. doi: 10.1056/NEJMoa1509277. Epub 2016 Jun 12.
Ref 17	Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof; 2020-04-02.
Ref 18	Moxetumomab pasudotox in heavily pre-treated patients with relapsed/refractory hairy cell leukemia (HCL): long-term follow-up from the pivotal trial. J Hematol Oncol. 2021 Feb 24;14(1):35.
Ref 19	A Novel Anti-CD22 Anthracycline-Based Antibody-Drug Conjugate (ADC) That Overcomes Resistance to Auristatin-Based ADCs. Clin Cancer Res. 2015 Jul 15;21(14):3298-306. doi: 10.1158/1078-0432.CCR-14-2035. Epub 2015 Apr 3.
Ref 20	Polatuzumab vedotin or pinatuzumab vedotin plus rituximab in patients with relapsed or refractory non-Hodgkin lymphoma: final results from a phase 2 randomised study (ROMULUS). Lancet Haematol. 2019 May;6(5):e254-e265.
Ref 21	Continuous infusion of the anti-CD22 immunotoxin IgG-RFB4-SMPT-dgA in patients with B-cell lymphoma: a phase I study. Blood. 1995 Jun 15;85(12):3457-65.
Ref 22	Silvestrol antibody-drug conjugates and methods of use; 2017-12-14.
Ref 23	Pyrrolobenzodiazepine antibody drug conjugates and methods of use; 2017-04-06.
Ref 24	Pyrrolobenzodiazepines and conjugates thereof; 2015-04-09.
Ref 25	TAC-001, a toll-like receptor 9 (TLR9) agonist antibody conjugate targeting B cells, promotes anti-tumor immunity and favorable safety profile following systemic administration in preclinical models. Cancer Res (2021) 81 (13_Supplement): 1721.
Ref 26	A Phase I Pharmacokinetic (PK) and Safety Study of Trph-222 in Patients with Relapsed/Refractory B-Cell Non-Hodgkin Lymphoma (R/R NHL): Dose-Escalation Results. Blood 2020 Nov 5; 136(1): 41-42.
Ref 27	Introduction to basic information on anti-CD22 antibody drug-conjugates(Medarex/BMS).
Ref 28	Introduction to basic information on anti-CD22 antibody-drug conjugate(Ambrx).