Antibody Information

General Information of This Antibody
Antibody ID
ANI0QYT003
Antibody Name
Mozistobart
Organization
Tallac Therapeutics, Inc.
Synonyms
Mozistobart
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
B-cell receptor CD22 (CD22)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLLESGGGVVQPGGSLRLSCAASGFAFSIYDMNWVRQAPGKGLEWVSAISSGGGTTYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHSGYGTHWGVLFAYWGRGTLVT
VSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDIHGYLNWYQQKPGKAPKLLIYYTSILHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYFCQQGSTLPWTFGQGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
TAC-001 [Phase 1/2]
 ADC Info 
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Key inclusion: Histologically/cytologically confirmed solid tumors, ECOG PS 0-1, and adequate organ function
Administration Dosage
TAC-001 Single-Agent Dose-Escalation Cohorts
Related Clinical Trial
NCT Number NCT05399654  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase 1/2, Open Label, Dose Escalation and Expansion Study of TAC-001 in Patients With Select Advanced or Metastatic Solid Tumors
Primary Endpoint
Primary objectives include determining the RP2D of TAC-001 monotherapy in advanced/metastatic solid tumors [2 years], and evaluating preliminary efficacy through ORR (CR+PR), duration of response, and clinical benefit rate per RECIST 1.1/iRECIST [2 years].
Other Endpoint
Secondary endpoints assess safety (AE/SAE/irAE incidence via CTCAE v5.0 [2 years]), pharmacokinetics (Cmax, Tmax, AUC, half-life, clearance [2 years]), and immunogenicity (ADA incidence [2 years]).
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT05399654  Clinical Status Phase 1/2
Clinical Description
A phase 1/2, open label, dose escalation and expansion study of TAC-001 in patients with select advanced or metastatic solid tumors.
References
Ref 1 A Dose Escalation and Expansion Study of TAC-001 in Patients With Select Advanced or Metastatic Solid Tumors
Ref 2 A Phase 1/2, Open Label, Dose Escalation and Expansion Study of TAC-001 in Patients With Select Advanced or Metastatic Solid Tumors, NCT05399654