General Information of This Antigen
Antigen ID
TAR0NNHUU
Antigen Name
Glypican-3 (GPC3)
Gene Name
GPC3
Gene ID
2719
Synonym
OCI5; GTR2-2;Intestinal protein OCI-5;MXR7
Sequence
MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQL.LNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHA
KNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQL
MNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINT
TDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILS
LEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYY
PEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLC
WNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGR
VLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQA
TPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH

    Click to Show/Hide
Family
Glycosyltransferase 29 family
Function
Cell surface proteoglycan. Negatively regulates the hedgehog signaling pathway when attached via the GPI- anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins. Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation. Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands. Positively regulates the non-canonical Wnt signaling pathway. Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression. Inhibits the dipeptidyl peptidase activity of DPP4. Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4. Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis. Required for coronary vascular development. Plays a role in regulating cell movements during gastrulation.

    Click to Show/Hide
Uniprot Entry
GPC3_HUMAN
HGNC ID
HGNC:4451
KEGG ID
hsa:2719
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Adnectins scaffold protein
ADC Info ADC Name Payload Target Linker Ref
Glypican 3 ADC
Tubulysin analog Tub
Human Deoxyribonucleic acid (hDNA)
Mal-EBE-Mal
[1]
Anti-GPC3 mAb
ADC Info ADC Name Payload Target Linker Ref
Anti-GPC3 ADC
Undisclosed
Undisclosed
Undisclosed
[2]
Anti-GPC3 mAb 4A6
ADC Info ADC Name Payload Target Linker Ref
Anti-GPC3 mAb 4A6-IIIa-01
Anti-GPC3 mAb 4A6-IIIa-01 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-01 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-02
Anti-GPC3 mAb 4A6-IIIa-02 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-02 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-03
Anti-GPC3 mAb 4A6-IIIa-03 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-03 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-04
Anti-GPC3 mAb 4A6-IIIa-04 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-04 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-05
Anti-GPC3 mAb 4A6-IIIa-05 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-05 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-06
Anti-GPC3 mAb 4A6-IIIa-06 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-06 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-07
Anti-GPC3 mAb 4A6-IIIa-07 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-07 linker
[3]
Anti-GPC3 mAb 4A6-IIIa-08
Anti-GPC3 mAb 4A6-IIIa-08 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIa-08 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-01
Anti-GPC3 mAb 4A6-IIIb-01 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-01 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-02
Anti-GPC3 mAb 4A6-IIIb-02 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-02 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-03
Anti-GPC3 mAb 4A6-IIIb-03 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-03 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-04
Anti-GPC3 mAb 4A6-IIIb-04 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-04 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-05
Anti-GPC3 mAb 4A6-IIIb-05 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-05 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-06
Anti-GPC3 mAb 4A6-IIIb-06 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-06 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-07
Anti-GPC3 mAb 4A6-IIIb-07 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-07 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-08
Anti-GPC3 mAb 4A6-IIIb-08 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-08 linker
[3]
Anti-GPC3 mAb 4A6-IIIb-09
Anti-GPC3 mAb 4A6-IIIb-09 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIb-09 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-01
Anti-GPC3 mAb 4A6-IIIc-01 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-01 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-02
Anti-GPC3 mAb 4A6-IIIc-02 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-02 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-03
Anti-GPC3 mAb 4A6-IIIc-03 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-03 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-04
Anti-GPC3 mAb 4A6-IIIc-04 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-04 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-05
Anti-GPC3 mAb 4A6-IIIc-05 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-05 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-06
Anti-GPC3 mAb 4A6-IIIc-06 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-06 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-07
Anti-GPC3 mAb 4A6-IIIc-07 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-07 linker
[3]
Anti-GPC3 mAb 4A6-IIIc-08
Anti-GPC3 mAb 4A6-IIIc-08 payload
Undisclosed
Anti-GPC3 mAb 4A6-IIIc-08 linker
[3]
Anti-GPC3 mAb A18
ADC Info ADC Name Payload Target Linker Ref
A18-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb A43
ADC Info ADC Name Payload Target Linker Ref
A43-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb A5
ADC Info ADC Name Payload Target Linker Ref
A5-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb C46
ADC Info ADC Name Payload Target Linker Ref
C46-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb F5
ADC Info ADC Name Payload Target Linker Ref
F5-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb F67
ADC Info ADC Name Payload Target Linker Ref
F67-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb G15
ADC Info ADC Name Payload Target Linker Ref
G15-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb H49
ADC Info ADC Name Payload Target Linker Ref
H49-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb HN3
ADC Info ADC Name Payload Target Linker Ref
HN3-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb I34
ADC Info ADC Name Payload Target Linker Ref
I34-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb I82
ADC Info ADC Name Payload Target Linker Ref
I82-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb I88
ADC Info ADC Name Payload Target Linker Ref
I88-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb J58
ADC Info ADC Name Payload Target Linker Ref
J58-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb J80A
ADC Info ADC Name Payload Target Linker Ref
J80A-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb J80B
ADC Info ADC Name Payload Target Linker Ref
J80B-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Anti-GPC3 mAb R6
ADC Info ADC Name Payload Target Linker Ref
R6-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[4]
Humanized Anti-GPC3 IgG1 mAb
ADC Info ADC Name Payload Target Linker Ref
ZW-251
ZD06519
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly-AM
[5]
Humanized GPC3-specific Anti-ody YP7
ADC Info ADC Name Payload Target Linker Ref
HYP7-DC
Duocarmycin Sa
Human Deoxyribonucleic acid (hDNA)
Mal-PEG4-Val-Cit-PABC-DMAE
[6]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
BMS-986183
Tubulysin
Microtubule (MT)
Valine-Citrulline
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.938439823; Fold-change: -0.065420416; Z-score: -0.26952202
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.35975789; Fold-change: 0.17811914; Z-score: 0.417428688
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000361832; Fold-change: -0.289386257; Z-score: -2.031088886
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.600781583; Fold-change: -0.373694064; Z-score: -1.405296481
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.29E-17; Fold-change: 0.319820564; Z-score: 0.622806264
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.662239268; Fold-change: -0.028440386; Z-score: -0.212670174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.905000646; Fold-change: -0.100432891; Z-score: -0.741220535
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.688222537; Fold-change: -0.021340038; Z-score: -0.15542351
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.092196686; Fold-change: -0.173766743; Z-score: -1.351422059
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.723235505; Fold-change: -0.050422821; Z-score: -0.253926851
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060428805; Fold-change: -0.650775838; Z-score: -3.770681117
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.336853783; Fold-change: -0.032988295; Z-score: -0.061533113
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.60E-20; Fold-change: 0.194888769; Z-score: 0.673059425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 9.96E-09; Fold-change: 0.062620548; Z-score: 0.263428126
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.96E-05; Fold-change: -0.513288955; Z-score: -1.229564347
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.017098426; Fold-change: -0.181240202; Z-score: -0.381718886
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.54E-86; Fold-change: 3.000632912; Z-score: 9.740175137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.70E-82; Fold-change: 2.932208456; Z-score: 4.075593289
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 2.68E-06; Fold-change: 3.274521248; Z-score: 11.14188921
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.52E-92; Fold-change: -1.237593412; Z-score: -3.015870007
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.68E-58; Fold-change: -1.342323674; Z-score: -2.895482485
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.210330167; Fold-change: -0.323451817; Z-score: -0.496257928
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.56E-12; Fold-change: 0.028007485; Z-score: 0.088567483
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.004607753; Fold-change: 0.062410622; Z-score: 0.440413231
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.62E-157; Fold-change: -1.726463738; Z-score: -3.385294741
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.79E-28; Fold-change: -1.356454806; Z-score: -3.230631668
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.064048106; Fold-change: -0.652024238; Z-score: -0.764495057
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.378832378; Fold-change: -0.062781343; Z-score: -0.161261566
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003367663; Fold-change: 0.071931653; Z-score: 0.318687351
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011896636; Fold-change: 0.07727215; Z-score: 0.214898973
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.74E-09; Fold-change: 0.453757739; Z-score: 6.01396071
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.94108091; Fold-change: -0.000701295; Z-score: -0.001210901
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.350740773; Fold-change: -0.214760925; Z-score: -0.850884255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.35E-05; Fold-change: -0.577790714; Z-score: -2.123811918
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.15E-59; Fold-change: -0.866466179; Z-score: -3.045672898
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.50E-14; Fold-change: -0.914899213; Z-score: -1.880409439
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 4.45E-12; Fold-change: -1.005776506; Z-score: -3.606176501
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.810405306; Fold-change: -0.143593739; Z-score: -0.271550698
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.32E-05; Fold-change: -1.369406736; Z-score: -2.112917322
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.73E-06; Fold-change: -1.437541726; Z-score: -2.189700661
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.363690765; Fold-change: 0.761858521; Z-score: 1.360443863
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003337453; Fold-change: 0.044853076; Z-score: 0.106051371
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.364581589; Fold-change: -0.258260339; Z-score: -1.132845854
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.35E-07; Fold-change: -0.376067697; Z-score: -1.705121623
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.53585878; Fold-change: -0.01036193; Z-score: -0.158734869
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.140636851; Fold-change: 0.254976839; Z-score: 2.01229536
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.373105654; Fold-change: 0.148564382; Z-score: 0.879834739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.75341754; Fold-change: 0.356095301; Z-score: 0.719161526
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.414684568; Fold-change: -0.099174676; Z-score: -0.374500865
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.041089829; Fold-change: 0.049607163; Z-score: 0.546422629
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.214144345; Fold-change: -0.019966852; Z-score: -0.117984851
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01471019; Fold-change: 0.265884324; Z-score: 2.599385559
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.434768039; Fold-change: -0.002059406; Z-score: -0.012542333
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040928385; Fold-change: -0.074926701; Z-score: -0.40564945
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.39600599; Fold-change: 0.018681549; Z-score: 0.095308326
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.119688261; Fold-change: -0.055806225; Z-score: -0.526739164
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.372352271; Fold-change: -0.096424504; Z-score: -1.416654398
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.254778112; Fold-change: -0.00536928; Z-score: -0.007533543
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.038033736; Fold-change: -0.129376391; Z-score: -1.805505919
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.51843092; Fold-change: -0.16885035; Z-score: -0.379284409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.091850851; Fold-change: -0.099377253; Z-score: -0.734988643
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.37E-09; Fold-change: -1.933350127; Z-score: -3.119392639
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.866271569; Fold-change: -0.010034114; Z-score: -0.128037707
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.928964774; Fold-change: -0.11435625; Z-score: -0.506037397
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.181570665; Fold-change: 0.060082174; Z-score: 0.362131232
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.116213191; Fold-change: -0.12715079; Z-score: -0.412650406
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056566015; Fold-change: -0.098770006; Z-score: -0.339408549
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.061415633; Fold-change: 0.002066518; Z-score: 0.008764073
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013345432; Fold-change: -0.206171838; Z-score: -0.44198305
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.177465693; Fold-change: 0.007800565; Z-score: 0.073229471
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060178129; Fold-change: -0.157759618; Z-score: -0.611242616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.104166488; Fold-change: 0.03216993; Z-score: 0.140738066
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.926115418; Fold-change: 0.037713851; Z-score: 0.124865375
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008107076; Fold-change: 0.435501499; Z-score: 1.516549176
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.044107752; Fold-change: 0.088440648; Z-score: 0.488144849
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.24884442; Fold-change: -0.047031877; Z-score: -0.196363322
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.88E-07; Fold-change: -0.538595513; Z-score: -2.100786723
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.84E-14; Fold-change: -0.469708243; Z-score: -1.114791798
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.62E-07; Fold-change: -0.303016765; Z-score: -0.738799249
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.802397952; Fold-change: 0.091681692; Z-score: 0.169738297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019411014; Fold-change: 0.153733163; Z-score: 0.485034179
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.651913486; Fold-change: -0.068714105; Z-score: -0.247624038
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028406189; Fold-change: -0.261707647; Z-score: -1.491095172
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.211453298; Fold-change: 0.04778648; Z-score: 0.437768057
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.288145407; Fold-change: 0.016924542; Z-score: 0.083798906
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002835308; Fold-change: 0.160408439; Z-score: 1.103550779
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.477252215; Fold-change: 0.111231278; Z-score: 0.324436128
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.237536116; Fold-change: 0.057332078; Z-score: 0.50296937
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.15E-05; Fold-change: 0.273387953; Z-score: 1.265262698
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001621438; Fold-change: -1.290848563; Z-score: -3.360810238
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.436358789; Fold-change: 0.092457595; Z-score: 0.417540579
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006924615; Fold-change: 0.029909101; Z-score: 0.173481444
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000467877; Fold-change: -0.559649591; Z-score: -2.198349432
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113066074; Fold-change: 0.085689185; Z-score: 0.774134242
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.098523325; Fold-change: -0.307994356; Z-score: -0.544389137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.004927587; Fold-change: 0.335934335; Z-score: 0.458319331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.972561805; Fold-change: 0.059211632; Z-score: 0.116922199
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.550894878; Fold-change: 0.098762242; Z-score: 0.374111107
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.037350374; Fold-change: 0.191063515; Z-score: 0.971317295
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.72E-36; Fold-change: -0.829024946; Z-score: -2.035090933
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.07E-19; Fold-change: -0.663676392; Z-score: -1.584429941
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.36E-05; Fold-change: -2.0123076; Z-score: -2.527845165
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.69E-25; Fold-change: -1.318518489; Z-score: -3.645184682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.5309679; Fold-change: -0.001001563; Z-score: -0.006205982
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.725582734; Fold-change: 0.001831977; Z-score: 0.00727565
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03524457; Fold-change: 0.152961928; Z-score: 2.160913344
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.076848674; Fold-change: 0.384237892; Z-score: 0.874228726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.697239601; Fold-change: 0.016883379; Z-score: 0.109508691
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.535917238; Fold-change: 0.006731383; Z-score: 0.05199996
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.907276029; Fold-change: 0.003781948; Z-score: 0.049580255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.149342314; Fold-change: -0.134738526; Z-score: -1.239481615
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.574025879; Fold-change: -0.080543258; Z-score: -0.646748113
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.493433518; Fold-change: 0.123920661; Z-score: 0.826504964
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310087984; Fold-change: 0.084687282; Z-score: 0.472870207
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.105442135; Fold-change: -0.095733643; Z-score: -0.602174236
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.372719252; Fold-change: 0.070319606; Z-score: 0.422242879
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.133986912; Fold-change: -0.092066633; Z-score: -0.481465666
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000793896; Fold-change: 0.697957306; Z-score: 1.61765151
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.327632015; Fold-change: 0.033515794; Z-score: 0.329764347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053014288; Fold-change: -0.042480247; Z-score: -0.35808576
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.284142446; Fold-change: 0.024161731; Z-score: 0.134896272
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.989387521; Fold-change: 0.024207507; Z-score: 0.135461269
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.281038858; Fold-change: 0.061015875; Z-score: 0.667419149
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.784144837; Fold-change: -0.017660055; Z-score: -0.116294174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.849911096; Fold-change: 0.038591511; Z-score: 0.272506063
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.151405619; Fold-change: 0.259862496; Z-score: 1.44526157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.876516654; Fold-change: 0.156895919; Z-score: 0.516541347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.10E-08; Fold-change: 1.165444437; Z-score: 3.536709149
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002324457; Fold-change: 0.346818154; Z-score: 1.24693553
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Adnectin-drug conjugates for Glypican-3-specific delivery of a cytotoxic payload to tumors. Protein Eng Des Sel. 2018 May 1;31(5):159-171. doi: 10.1093/protein/gzy013.
Ref 2 A novel semi-mechanistic tumor growth fraction model for translation of preclinical efficacy of anti-glypican 3 antibody drug conjugate to human. Biopharm Drug Dispos. 2020 Nov;41(8-9):319-333. doi: 10.1002/bdd.2249. Epub 2020 Aug 19.
Ref 3 Benzodiazepine dimers, conjugates thereof, and methods of making and using.
Ref 4 Highly Potent Immunotoxins Targeting the Membrane-distal N-lobe of GPC3 for Immunotherapy of Hepatocellular Carcinoma. J Cancer. 2022 Feb 14;13(4):1370-1384.
Ref 5 ZW251, a novel glypican-3-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 2658.
Ref 6 Glypican-3-Specific Antibody Drug Conjugates Targeting Hepatocellular Carcinoma. Hepatology. 2019 Aug;70(2):563-576. doi: 10.1002/hep.30326. Epub 2019 Feb 19.