Antigen ID	TAR0ZHRFU
Antigen Name	Glutamate carboxypeptidase 2 (FOLH1)
Gene Name	FOLH1
Gene ID	2346
Synonym	Cell growth-inhibiting gene 27 protein; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; N-acetylated-alpha-linked acidic dipeptidase I; Prostate-specific membrane antigen; Pteroylpoly-gamma-glutamate carboxypeptidase
Sequence	MWNLLHETDSAVA.RPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFL DELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNK THPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYART EDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSY PDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDA QKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTL RGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWD AEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELK SPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWE TNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAV VLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLR MMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPS KAWGEVKRQIYVAAFTVQAAAETLSEVA     Click to Show/Hide
Family	Peptidase M28 family
Function	Has both folate hydrolase and N-acetylated-alpha-linked- acidic dipeptidase (NAALADase) activity. Has a preference for tri- alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.     Click to Show/Hide
Uniprot Entry	FOLH1_HUMAN
HGNC ID	HGNC:3788
KEGG ID	hsa:2346

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Monoclonal antibody 7E11 C5-selenocystamine conjugate	Undisclosed	Undisclosed	Undisclosed	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	111In-DTPA-D2B-DAR4-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]
ADC Info	111In-DTPA-D2B-DAR2-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-15	DM1 derivative 15	Microtubule (MT)	Mc-Val-Cit-PABC	[3]
ADC Info	PSMA-16	DM1 derivative 16	Microtubule (MT)	Mc-Val-Cit-PABC	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	111In-DOTA-5D3	Indium-111	Human Deoxyribonucleic acid (hDNA)	Tetraxetan	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	D2B-DCM	Duocarmycin A	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Cit-PABC	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	h3/F11-Var16 (Anti-PSMA)-30.2060	Amanitin 30.206	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	h3/F11-Var16 (Anti-PSMA)-30.2867	Amanitin 30.2867	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Maleimido-caproyl	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	hD7-1 (VL-VH)-PE24mut	Pseudomonas exotoxin PE24 mut	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[7]
ADC Info	hD7-1 (VL-VH)-PE40	Pseudomonas exotoxin PE40	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[7]
ADC Info	hD7-1 (VL-VH)-PE24	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SYD998	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]
ADC Info	WO2015177360A1 ADC-wt-vcMMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	WO2015177360A1 ADC-wt-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC339	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC376	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC152	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC236	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC153	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC247	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC375	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SYD1091	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]
ADC Info	WO2015177360A1 ADC-HC41-vcMMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	WO2015177360A1 ADC-HC41-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC41-375	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-HC41-120	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SYD1035	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC205	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC157	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC41	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]
ADC Info	WO2015177360A1 ADC-LC41-vcMMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	WO2015177360A1 ADC-LC41-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC165	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC154	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]
ADC Info	WO2015177360A1 ADC-LC40-vcMMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	WO2015177360A1 ADC-LC40-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC109	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2015177360A1 ADC-LC40	seco-DUBA	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2-Val-Cit-PABA-Cyclization Spacer	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	124I-scFvD2B	Iodine I-124	Undisclosed	Undisclosed	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-PSMA-D265C-30.2060	Amanitin 30.206	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	Anti-PSMA-D265C-30.2115	Amanitin 30.2115	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	Anti-PSMA-D265C-30.2347	Amanitin 30.2347	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	Anti-PSMA-D265C-30.1699	Amanitin 30.1699	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	Anti-PSMA-D265C-30.2371	Amanitin 30.2371	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[6]
ADC Info	Anti-PSMA-D265C-30.0880	Amanitin 30.088	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Maleimido-caproyl	[6]
ADC Info	Anti-PSMA-D265C-30.2867	Amanitin 30.2867	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Maleimido-caproyl	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-ADC	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MEDI-3726	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-D Antibody-Compound (X)	PSMA-D Antibody-Compound (X) payload	Undisclosed	PSMA-D Antibody-Compound (X) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XI)	PSMA-D Antibody-Compound (XI) payload	Undisclosed	PSMA-D Antibody-Compound (XI) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XIV)	PSMA-D Antibody-Compound (XIV) payload	Undisclosed	PSMA-D Antibody-Compound (XIV) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XVIII)	PSMA-D Antibody-Compound (XVIII) payload	Undisclosed	PSMA-D Antibody-Compound (XVIII) linker	[12]
ADC Info	PSMA-D Antibody-Compound (Ie)	PSMA-D Antibody-Compound (Ie) payload	Undisclosed	PSMA-D Antibody-Compound (Ie) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XIX)	PSMA-D Antibody-Compound (XIX) payload	Undisclosed	PSMA-D Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-D Antibody-Compound (Ii)	PSMA-D Antibody-Compound (Ii) payload	Undisclosed	PSMA-D Antibody-Compound (Ii) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XLI)	PSMA-D Antibody-Compound (XLI) payload	Undisclosed	PSMA-D Antibody-Compound (XLI) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XVI)	PSMA-D Antibody-Compound (XIX) payload	Undisclosed	PSMA-D Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XL)	PSMA-D Antibody-Compound (XL) payload	Undisclosed	PSMA-D Antibody-Compound (XL) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XLII)	PSMA-D Antibody-Compound (XLII) payload	Undisclosed	PSMA-D Antibody-Compound (XLII) linker	[12]
ADC Info	J591-SC239C-Compound (XV)	J591-SC239C-Compound (XV) payload	Undisclosed	J591-SC239C-Compound (XV) linker	[12]
ADC Info	PSMA-D Antibody-Compound (XLIII)	PSMA-D Antibody-Compound (XLIII) payload	Undisclosed	PSMA-D Antibody-Compound (XLIII) linker	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MLN2704	Mertansine DM1	Microtubule (MT)	Thiopentanoate linker	[13]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-A Antibody-Compound (X)	PSMA-A Antibody-Compound (X) payload	Undisclosed	PSMA-A Antibody-Compound (X) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XI)	PSMA-A Antibody-Compound (XI) payload	Undisclosed	PSMA-A Antibody-Compound (XI) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XIV)	PSMA-A Antibody-Compound (XIV) payload	Undisclosed	PSMA-A Antibody-Compound (XIV) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XVIII)	PSMA-A Antibody-Compound (XVIII) payload	Undisclosed	PSMA-A Antibody-Compound (XVIII) linker	[12]
ADC Info	PSMA-A Antibody-Compound (Ie)	PSMA-A Antibody-Compound (Ie) payload	Undisclosed	PSMA-A Antibody-Compound (Ie) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XIX)	PSMA-A Antibody-Compound (XIX) payload	Undisclosed	PSMA-A Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-A Antibody-Compound (Ii)	PSMA-A Antibody-Compound (Ii) payload	Undisclosed	PSMA-A Antibody-Compound (Ii) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XLI)	PSMA-A Antibody-Compound (XLI) payload	Undisclosed	PSMA-A Antibody-Compound (XLI) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XVI)	PSMA-A Antibody-Compound (XIX) payload	Undisclosed	PSMA-A Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XL)	PSMA-A Antibody-Compound (XL) payload	Undisclosed	PSMA-A Antibody-Compound (XL) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XLII)	PSMA-A Antibody-Compound (XLII) payload	Undisclosed	PSMA-A Antibody-Compound (XLII) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XV)	PSMA-A Antibody-Compound (XV) payload	Undisclosed	PSMA-A Antibody-Compound (XV) linker	[12]
ADC Info	PSMA-A Antibody-Compound (XLIII)	PSMA-A Antibody-Compound (XLIII) payload	Undisclosed	PSMA-A Antibody-Compound (XLIII) linker	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-B Antibody-Compound (X)	PSMA-B Antibody-Compound (X) payload	Undisclosed	PSMA-B Antibody-Compound (X) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XI)	PSMA-B Antibody-Compound (XI) payload	Undisclosed	PSMA-B Antibody-Compound (XI) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XIV)	PSMA-B Antibody-Compound (XIV) payload	Undisclosed	PSMA-B Antibody-Compound (XIV) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XVIII)	PSMA-B Antibody-Compound (XVIII) payload	Undisclosed	PSMA-B Antibody-Compound (XVIII) linker	[12]
ADC Info	PSMA-B Antibody-Compound (Ie)	PSMA-B Antibody-Compound (Ie) payload	Undisclosed	PSMA-B Antibody-Compound (Ie) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XIX)	PSMA-B Antibody-Compound (XIX) payload	Undisclosed	PSMA-B Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-B Antibody-Compound (Ii)	PSMA-B Antibody-Compound (Ii) payload	Undisclosed	PSMA-B Antibody-Compound (Ii) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XLI)	PSMA-B Antibody-Compound (XLI) payload	Undisclosed	PSMA-B Antibody-Compound (XLI) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XVI)	PSMA-B Antibody-Compound (XIX) payload	Undisclosed	PSMA-B Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XL)	PSMA-B Antibody-Compound (XL) payload	Undisclosed	PSMA-B Antibody-Compound (XL) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XLII)	PSMA-B Antibody-Compound (XLII) payload	Undisclosed	PSMA-B Antibody-Compound (XLII) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XV)	PSMA-B Antibody-Compound (XV) payload	Undisclosed	PSMA-B Antibody-Compound (XV) linker	[12]
ADC Info	PSMA-B Antibody-Compound (XLIII)	PSMA-B Antibody-Compound (XLIII) payload	Undisclosed	PSMA-B Antibody-Compound (XLIII) linker	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PSMA-C Antibody-Compound (X)	PSMA-C Antibody-Compound (X) payload	Undisclosed	PSMA-C Antibody-Compound (X) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XI)	PSMA-C Antibody-Compound (XI) payload	Undisclosed	PSMA-C Antibody-Compound (XI) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XIV)	PSMA-C Antibody-Compound (XIV) payload	Undisclosed	PSMA-C Antibody-Compound (XIV) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XVIII)	PSMA-C Antibody-Compound (XVIII) payload	Undisclosed	PSMA-C Antibody-Compound (XVIII) linker	[12]
ADC Info	PSMA-C Antibody-Compound (Ie)	PSMA-C Antibody-Compound (Ie) payload	Undisclosed	PSMA-C Antibody-Compound (Ie) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XIX)	PSMA-C Antibody-Compound (XIX) payload	Undisclosed	PSMA-C Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-C Antibody-Compound (Ii)	PSMA-C Antibody-Compound (Ii) payload	Undisclosed	PSMA-C Antibody-Compound (Ii) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XLI)	PSMA-C Antibody-Compound (XLI) payload	Undisclosed	PSMA-C Antibody-Compound (XLI) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XVI)	PSMA-C Antibody-Compound (XIX) payload	Undisclosed	PSMA-C Antibody-Compound (XIX) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XL)	PSMA-C Antibody-Compound (XL) payload	Undisclosed	PSMA-C Antibody-Compound (XL) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XLII)	PSMA-C Antibody-Compound (XLII) payload	Undisclosed	PSMA-C Antibody-Compound (XLII) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XV)	PSMA-C Antibody-Compound (XV) payload	Undisclosed	PSMA-C Antibody-Compound (XV) linker	[12]
ADC Info	PSMA-C Antibody-Compound (XLIII)	PSMA-C Antibody-Compound (XLIII) payload	Undisclosed	PSMA-C Antibody-Compound (XLIII) linker	[12]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Rosopatamab tetraxetan	Y90 (Radioactive isotope)	Undisclosed	Tetraxetan	[14]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HDP-103	Alpha-amanitin	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Undisclosed	[15]
ADC Info	DAN-405	Cabazitaxel	Microtubule (MT)	Undisclosed	[16]
ADC Info	Anti-PSMA antibody-drug conjugate (Protanbio)	Undisclosed	Undisclosed	Undisclosed	[17]
ADC Info	PSMA ADC (Jiangsu hengrui)	Undisclosed	Undisclosed	Undisclosed	[18]
ADC Info	Anti-PSMA antibody-deBouganin fusion protein (Crescendo/Sesen Bio)	Undisclosed	Undisclosed	Undisclosed	[19]
ADC Info	MMAE.VC.SA.617	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[20]
ADC Info	Anti-PSMA antibody-drug conjugate	Undisclosed	Undisclosed	Undisclosed	[21]
ADC Info	CB-108	Undisclosed	Undisclosed	Undisclosed	[22]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.249838229; Fold-change: -0.00877963; Z-score: -0.021889
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.096826132; Fold-change: -0.310740876; Z-score: -3.221302421
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.10E-05; Fold-change: -2.979089199; Z-score: -2.551172216
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.86E-09; Fold-change: -1.662248488; Z-score: -5.929405602
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.70E-33; Fold-change: -0.61194288; Z-score: -0.798812922
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001010549; Fold-change: 0.051048264; Z-score: 0.369624587
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.09E-06; Fold-change: 0.151595017; Z-score: 0.951000097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.570117985; Fold-change: -0.018537427; Z-score: -0.059519519
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.391151262; Fold-change: -0.077430161; Z-score: -0.523411826
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.991740481; Fold-change: 0.045826995; Z-score: 0.314889352
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.979364998; Fold-change: -0.11747071; Z-score: -0.314138082
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.21E-05; Fold-change: 0.228501408; Z-score: 1.254505971
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.31E-08; Fold-change: 0.110268843; Z-score: 0.440829751
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.232960679; Fold-change: -0.014418156; Z-score: -0.044730924
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006754183; Fold-change: -0.308951815; Z-score: -0.813276667
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000129794; Fold-change: -0.385634438; Z-score: -0.345385456
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.05E-05; Fold-change: -0.403450792; Z-score: -0.661469795
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.19E-05; Fold-change: -0.119658023; Z-score: -0.342709861
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.086034272; Fold-change: -0.285334233; Z-score: -1.097146733
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015792328; Fold-change: 0.028381216; Z-score: 0.1033747
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.52E-08; Fold-change: 0.089010334; Z-score: 0.42900282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027391774; Fold-change: 0.86210157; Z-score: 0.882284737
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.41E-09; Fold-change: 0.09214561; Z-score: 0.419226668
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.088551002; Fold-change: -0.172232972; Z-score: -1.214646909
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.62E-19; Fold-change: -0.228680422; Z-score: -0.491123174
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003843658; Fold-change: -0.169896035; Z-score: -0.49235945
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113655822; Fold-change: -0.187295983; Z-score: -0.832702695
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.585731932; Fold-change: -0.254759947; Z-score: -0.890184685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.195559494; Fold-change: -0.149953683; Z-score: -0.492204851
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.39E-08; Fold-change: -0.34946057; Z-score: -0.83976276
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.079631242; Fold-change: 0.145631797; Z-score: 0.540877282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.40E-09; Fold-change: 2.075991168; Z-score: 2.207145965
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.97E-09; Fold-change: 1.146565091; Z-score: 7.224479893
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-07; Fold-change: -0.455828885; Z-score: -3.170301208
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.96E-08; Fold-change: 0.219047778; Z-score: 0.767679927
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.151476383; Fold-change: 0.082023481; Z-score: 0.258114041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.410664414; Fold-change: 9.94E-05; Z-score: 0.001480263
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00414592; Fold-change: -0.061330166; Z-score: -0.247066784
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.447616605; Fold-change: -0.165320148; Z-score: -0.529651608
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.479672363; Fold-change: 0.095868977; Z-score: 0.289201596
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128678186; Fold-change: 0.052720069; Z-score: 0.451625936
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.037282829; Fold-change: 0.070101445; Z-score: 0.14465812
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.755078416; Fold-change: 0.080376245; Z-score: 0.240440156
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.368485796; Fold-change: -0.174194657; Z-score: -0.811465957
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.685815693; Fold-change: -0.022433484; Z-score: -0.12448102
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.026135578; Fold-change: -0.302510192; Z-score: -1.380010032
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.568562127; Fold-change: -0.029925823; Z-score: -0.147390282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.468469261; Fold-change: -0.154281991; Z-score: -0.556977739
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000134177; Fold-change: -0.311489351; Z-score: -1.142208278
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.288832525; Fold-change: 0.026312297; Z-score: 0.154763556
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.886264273; Fold-change: -0.101277997; Z-score: -0.307974414
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.49905218; Fold-change: 0.116483995; Z-score: 0.450255789
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.069161059; Fold-change: 0.143720708; Z-score: 0.834491174
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.109576669; Fold-change: 0.067875553; Z-score: 0.255904434
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.34E-06; Fold-change: 0.192879144; Z-score: 0.58846754
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.63003871; Fold-change: -0.019564358; Z-score: -0.118415074
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070264574; Fold-change: -0.220696969; Z-score: -2.304229763
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.333424478; Fold-change: 0.176539723; Z-score: 0.208508726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.634386765; Fold-change: -0.036825257; Z-score: -0.174896193
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.744603375; Fold-change: 0.2163258; Z-score: 0.309289134
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.75755819; Fold-change: -0.029523339; Z-score: -0.240233629
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.400176687; Fold-change: 0.089490213; Z-score: 0.288049817
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.686583846; Fold-change: 0.020437627; Z-score: 0.201477545
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.977384748; Fold-change: -0.183272691; Z-score: -0.500718405
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.294616274; Fold-change: 0.041153475; Z-score: 0.146825583
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.159824677; Fold-change: 0.132661974; Z-score: 0.734525216
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01460039; Fold-change: 0.157826177; Z-score: 0.644900651
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.929659249; Fold-change: -0.020737966; Z-score: -0.066430891
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000731507; Fold-change: -0.191861749; Z-score: -0.194341433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.365399979; Fold-change: 0.06628046; Z-score: 0.316351433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.346173915; Fold-change: -0.100033947; Z-score: -0.339626333
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.038484715; Fold-change: 0.097508092; Z-score: 0.234246456
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.572886838; Fold-change: 0.036495697; Z-score: 0.175130212
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002655423; Fold-change: 0.275372702; Z-score: 2.073906804
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.9310993; Fold-change: -0.033342569; Z-score: -0.103119127
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.791275166; Fold-change: 0.082156317; Z-score: 0.169981755
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.112255346; Fold-change: 0.074736406; Z-score: 0.326300353
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.87E-07; Fold-change: 0.222316539; Z-score: 0.707128102
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.54E-15; Fold-change: 0.563055396; Z-score: 1.158212728
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618036859; Fold-change: 0.030257251; Z-score: 0.059323873
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.179172525; Fold-change: 0.11706516; Z-score: 0.259325218
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.947985327; Fold-change: -0.100299384; Z-score: -0.71130584
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.977542363; Fold-change: -0.011290647; Z-score: -0.064645517
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.156469445; Fold-change: 0.068639543; Z-score: 0.399670876
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.662418918; Fold-change: -0.032565498; Z-score: -0.122118824
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.783912884; Fold-change: 0.109323559; Z-score: 0.26258022
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.478849046; Fold-change: -0.073387902; Z-score: -0.335159638
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.896294496; Fold-change: -0.057871945; Z-score: -0.400777863
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.997905875; Fold-change: -0.060686388; Z-score: -0.178552465
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.41752326; Fold-change: -0.036931716; Z-score: -0.313013849
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.609407244; Fold-change: -0.138138524; Z-score: -0.474153284
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02600897; Fold-change: 0.060284347; Z-score: 0.286782876
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001455673; Fold-change: -0.593840622; Z-score: -1.657925726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.461256759; Fold-change: 0.146970416; Z-score: 1.050452288
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000269115; Fold-change: -0.561019193; Z-score: -1.197704866
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.550903291; Fold-change: -0.08797114; Z-score: -0.196617409
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.887382058; Fold-change: 0.157646343; Z-score: 0.391419506
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.139464317; Fold-change: 0.177885709; Z-score: 0.788133101
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.137861466; Fold-change: 0.1554891; Z-score: 0.676511615
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004111472; Fold-change: -0.020564864; Z-score: -0.045703443
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.43E-11; Fold-change: 0.332323397; Z-score: 0.634446245
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.520480404; Fold-change: -0.26413761; Z-score: -0.666866039
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.77E-11; Fold-change: -0.545897606; Z-score: -0.797402761
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.838482666; Fold-change: -0.1195786; Z-score: -0.297551839
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.58277558; Fold-change: -0.059602929; Z-score: -0.771397697
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.79259956; Fold-change: -0.198528833; Z-score: -1.544607995
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.25749816; Fold-change: 0.465514238; Z-score: 1.087936651
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.48227528; Fold-change: 0.005055487; Z-score: 0.024093353
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.111872357; Fold-change: 0.101748331; Z-score: 0.634103547
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.267333413; Fold-change: 0.059695117; Z-score: 0.341757371
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.611583385; Fold-change: 0.083163244; Z-score: 0.178554911
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.155434646; Fold-change: -0.075353723; Z-score: -0.908178014
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.338979207; Fold-change: 0.191723474; Z-score: 0.994937896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.456350805; Fold-change: 0.200888398; Z-score: 0.905906176
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.778571138; Fold-change: 0.06055654; Z-score: 0.158405739
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.98450158; Fold-change: 0.044359526; Z-score: 0.239488581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.931473122; Fold-change: 0.009865986; Z-score: 0.073661494
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.913851328; Fold-change: 0.012779145; Z-score: 0.107138464
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.217206241; Fold-change: 0.128885026; Z-score: 1.210939674
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.306551985; Fold-change: -0.12281283; Z-score: -0.497976518
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082281287; Fold-change: 0.069715035; Z-score: 0.328480907
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.616413035; Fold-change: 0.025090147; Z-score: 0.094675194
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.484353326; Fold-change: 0.012048498; Z-score: 0.123603568
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.503074942; Fold-change: -0.036331277; Z-score: -0.053768054
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.567015415; Fold-change: -0.015895869; Z-score: -0.088861796
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048234529; Fold-change: 0.219100255; Z-score: 1.701126135
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.450237744; Fold-change: -0.006618677; Z-score: -0.035941645
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.185075371; Fold-change: 0.053550705; Z-score: 0.44743947
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.216452188; Fold-change: -0.131186875; Z-score: -0.886404213
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Monoclonal antibody 7E11 C5-selenocystamine conjugate; 29 Apr 2002.
Ref 2	Characterization of Site-Specifically Conjugated Monomethyl Auristatin E- and Duocarmycin-Based Anti-PSMA Antibody-Drug Conjugates for Treatment of PSMA-Expressing Tumors. J Nucl Med. 2018 Mar;59(3):494-501. doi: 10.2967/jnumed.117.196279. Epub 2017 Nov 16.
Ref 3	Antibody drug conjugates of cleavable amino-alkyl and aryl maytansinoids. Bioorg Med Chem. 2018 May 15;26(9):2271-2279. doi: 10.1016/j.bmc.2018.02.025. Epub 2018 Feb 21.
Ref 4	Evaluation of 111In-DOTA-5D3, a Surrogate SPECT Imaging Agent for Radioimmunotherapy of Prostate-Specific Membrane Antigen. J Nucl Med. 2019 Mar;60(3):400-406. doi: 10.2967/jnumed.118.214403. Epub 2018 Sep 20.
Ref 5	Duocarmycin-based antibody-drug conjugates as an emerging biotherapeutic entity for targeted cancer therapy: Pharmaceutical strategy and clinical progress. Drug Discov Today. 2021 Aug;26(8):1857-1874. doi: 10.1016/j.drudis.2021.06.012. Epub 2021 Jul 3.
Ref 6	Amatoxin antibody-drug conjugates and uses thereof; 2020-10-29.
Ref 7	In Vitro Evaluation of Humanized/De-immunized Anti-PSMA Immunotoxins for the Treatment of Prostate Cancer. Anticancer Res. 2018 Jan;38(1):61-69. doi: 10.21873/anticanres.12192.
Ref 8	Site-specific conjugation of linker drugs to antibodies and resulting adcs.
Ref 9	Anti-PSMA (124)I-scFvD2B as a new immuno-PET tool for prostate cancer: preclinical proof of principle. J Exp Clin Cancer Res. 2019 Jul 23;38(1):326. doi: 10.1186/s13046-019-1325-6.
Ref 10	Antibody-drug conjugates targeting prostate-specific membrane antigen. Front Biosci (Landmark Ed). 2014 Jan 1;19(1):12-33. doi: 10.2741/4193.
Ref 11	CMB-401
Ref 12	Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 13	Phase 1/2 multiple ascending dose trial of the prostate-specific membrane antigen-targeted antibody drug conjugate MLN2704 in metastatic castration-resistant prostate cancer. Urol Oncol. 2016 Dec;34(12):530.e15-530.e21.
Ref 14	ADC review ROSOPATAMAB TETRAXETAN
Ref 15	Heidelberg pharma product pipeline
Ref 16	Dantari biotechnology company product pipeline
Ref 17	Introduction to basic information on anti PRLR anti-PSMA antibody-drug conjugate(Protanbio).
Ref 18	Introduction to basic information on ADC drug PSMA ADC (Jiangsu hengrui)
Ref 19	Engineering and characterization of anti-PSMA humabody-deBouganin fusion proteins. Cancer Res (2018) 78 (13_Supplement): 5770.
Ref 20	Old Drug, New Delivery Strategy: MMAE Repackaged. Int J Mol Sci. 2023 May 10;24(10):8543. doi: 10.3390/ijms24108543.
Ref 21	Introduction to basic information on ADC drug Anti-PSMA antibody-drug conjugates(Medarex)
Ref 22	Multifunctional biologics for targeted T-cell therapy based on in vivo matured fully human VH domains. Cancer Res (2018) 78 (13_Supplement): 5766.