General Information of This Antigen
Antigen ID
TAR0ZHRFU
Antigen Name
Glutamate carboxypeptidase 2 (FOLH1)
Gene Name
FOLH1
Gene ID
2346
Synonym
Cell growth-inhibiting gene 27 protein; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; N-acetylated-alpha-linked acidic dipeptidase I; Prostate-specific membrane antigen; Pteroylpoly-gamma-glutamate carboxypeptidase
Sequence
MWNLLHETDSAVA.RPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFL
DELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNK
THPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYART
EDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSY
PDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDA
QKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTL
RGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWD
AEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELK
SPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWE
TNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAV
VLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLR
MMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPS
KAWGEVKRQIYVAAFTVQAAAETLSEVA

    Click to Show/Hide
Family
Peptidase M28 family
Function
Has both folate hydrolase and N-acetylated-alpha-linked- acidic dipeptidase (NAALADase) activity. Has a preference for tri- alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.

    Click to Show/Hide
Uniprot Entry
FOLH1_HUMAN
HGNC ID
HGNC:3788
KEGG ID
hsa:2346
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
ADC Info ADC Name Payload Target Linker Ref
Monoclonal antibody 7E11 C5-selenocystamine conjugate
Undisclosed
Undisclosed
Undisclosed
[1]
Anti-PSMA IgG1 mAb D2B
ADC Info ADC Name Payload Target Linker Ref
111In-DTPA-D2B-DAR2-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
111In-DTPA-D2B-DAR4-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
Anti-PSMA mAb
ADC Info ADC Name Payload Target Linker Ref
PSMA-15
DM1 derivative 15
Microtubule (MT)
Mc-Val-Cit-PABC
[3]
PSMA-16
DM1 derivative 16
Microtubule (MT)
Mc-Val-Cit-PABC
[3]
Anti-PSMA mAb 5D3
ADC Info ADC Name Payload Target Linker Ref
111In-DOTA-5D3
Indium-111
Human Deoxyribonucleic acid (hDNA)
Tetraxetan
[4]
Anti-PSMA mAb D2B
ADC Info ADC Name Payload Target Linker Ref
D2B-DCM
Duocarmycin A
Human Deoxyribonucleic acid (hDNA)
Mc-Val-Cit-PABC
[5]
Anti-PSMA mAb h3/F11-Var16
ADC Info ADC Name Payload Target Linker Ref
h3/F11-Var16 (Anti-PSMA)-30.2060
Amanitin 30.206
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
h3/F11-Var16 (Anti-PSMA)-30.2867
Amanitin 30.2867
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Maleimido-caproyl
[6]
Anti-PSMA mAb hD7-1
ADC Info ADC Name Payload Target Linker Ref
hD7-1 (VL-VH)-PE24
Pseudomonas exotoxin PE24
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[7]
hD7-1 (VL-VH)-PE24mut
Pseudomonas exotoxin PE24 mut
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[7]
hD7-1 (VL-VH)-PE40
Pseudomonas exotoxin PE40
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[7]
Anti-PSMA mAb wt
ADC Info ADC Name Payload Target Linker Ref
SYD998
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
WO2015177360A1 ADC-wt-mcMMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[8]
WO2015177360A1 ADC-wt-vcMMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
Anti-PSMA mAb wt HC A339C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC339
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC D376C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC376
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC E152C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC152
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC G236C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC236
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC P153C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC153
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC P247C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC247
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC S375C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC375
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC S41C
ADC Info ADC Name Payload Target Linker Ref
SYD1091
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
WO2015177360A1 ADC-HC41-mcMMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[8]
WO2015177360A1 ADC-HC41-vcMMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
Anti-PSMA mAb wt HC S41C/S375C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC41-375
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC S41C/T120C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-HC41-120
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt HC T120C
ADC Info ADC Name Payload Target Linker Ref
SYD1035
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt LC E165C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC205
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt LC G157C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC157
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt LC G41C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC41
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
WO2015177360A1 ADC-LC41-mcMMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[8]
WO2015177360A1 ADC-LC41-vcMMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
Anti-PSMA mAb wt LC L154C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC165
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt LC P40C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC154
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
WO2015177360A1 ADC-LC40-mcMMAF
Monomethyl auristatin F
Microtubule (MT)
Maleimido-caproyl
[8]
WO2015177360A1 ADC-LC40-vcMMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[8]
Anti-PSMA mAb wt LC T109C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC109
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA mAb wt LC V205C
ADC Info ADC Name Payload Target Linker Ref
WO2015177360A1 ADC-LC40
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer
[8]
Anti-PSMA scFv
ADC Info ADC Name Payload Target Linker Ref
124I-scFvD2B
Iodine I-124
Undisclosed
Undisclosed
[9]
Anti-PSMA-D265C
ADC Info ADC Name Payload Target Linker Ref
Anti-PSMA-D265C-30.0880
Amanitin 30.088
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Maleimido-caproyl
[6]
Anti-PSMA-D265C-30.1699
Amanitin 30.1699
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
Anti-PSMA-D265C-30.2060
Amanitin 30.206
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
Anti-PSMA-D265C-30.2115
Amanitin 30.2115
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
Anti-PSMA-D265C-30.2347
Amanitin 30.2347
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
Anti-PSMA-D265C-30.2371
Amanitin 30.2371
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Mc-Val-Ala-PABC
[6]
Anti-PSMA-D265C-30.2867
Amanitin 30.2867
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Maleimido-caproyl
[6]
Fully human IgG1 Anti-PSMA mAb
ADC Info ADC Name Payload Target Linker Ref
PSMA-ADC
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[10]
ADC Info ADC Name Payload Target Linker Ref
MEDI-3726
SG3199
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[11]
J591-SC239C
ADC Info ADC Name Payload Target Linker Ref
J591-SC239C-Compound (XV)
J591-SC239C-Compound (XV) payload
Undisclosed
J591-SC239C-Compound (XV) linker
[12]
PSMA-D Antibody-Compound (Ie)
PSMA-D Antibody-Compound (Ie) payload
Undisclosed
PSMA-D Antibody-Compound (Ie) linker
[12]
PSMA-D Antibody-Compound (Ii)
PSMA-D Antibody-Compound (Ii) payload
Undisclosed
PSMA-D Antibody-Compound (Ii) linker
[12]
PSMA-D Antibody-Compound (X)
PSMA-D Antibody-Compound (X) payload
Undisclosed
PSMA-D Antibody-Compound (X) linker
[12]
PSMA-D Antibody-Compound (XI)
PSMA-D Antibody-Compound (XI) payload
Undisclosed
PSMA-D Antibody-Compound (XI) linker
[12]
PSMA-D Antibody-Compound (XIV)
PSMA-D Antibody-Compound (XIV) payload
Undisclosed
PSMA-D Antibody-Compound (XIV) linker
[12]
PSMA-D Antibody-Compound (XIX)
PSMA-D Antibody-Compound (XIX) payload
Undisclosed
PSMA-D Antibody-Compound (XIX) linker
[12]
PSMA-D Antibody-Compound (XL)
PSMA-D Antibody-Compound (XL) payload
Undisclosed
PSMA-D Antibody-Compound (XL) linker
[12]
PSMA-D Antibody-Compound (XLI)
PSMA-D Antibody-Compound (XLI) payload
Undisclosed
PSMA-D Antibody-Compound (XLI) linker
[12]
PSMA-D Antibody-Compound (XLII)
PSMA-D Antibody-Compound (XLII) payload
Undisclosed
PSMA-D Antibody-Compound (XLII) linker
[12]
PSMA-D Antibody-Compound (XLIII)
PSMA-D Antibody-Compound (XLIII) payload
Undisclosed
PSMA-D Antibody-Compound (XLIII) linker
[12]
PSMA-D Antibody-Compound (XVI)
PSMA-D Antibody-Compound (XIX) payload
Undisclosed
PSMA-D Antibody-Compound (XIX) linker
[12]
PSMA-D Antibody-Compound (XVIII)
PSMA-D Antibody-Compound (XVIII) payload
Undisclosed
PSMA-D Antibody-Compound (XVIII) linker
[12]
ADC Info ADC Name Payload Target Linker Ref
MLN-2704
Mertansine DM1
Microtubule (MT)
Thiopentanoate linker
[13]
PSMA-A Anti-ody
ADC Info ADC Name Payload Target Linker Ref
PSMA-A Antibody-Compound (Ie)
PSMA-A Antibody-Compound (Ie) payload
Undisclosed
PSMA-A Antibody-Compound (Ie) linker
[12]
PSMA-A Antibody-Compound (Ii)
PSMA-A Antibody-Compound (Ii) payload
Undisclosed
PSMA-A Antibody-Compound (Ii) linker
[12]
PSMA-A Antibody-Compound (X)
PSMA-A Antibody-Compound (X) payload
Undisclosed
PSMA-A Antibody-Compound (X) linker
[12]
PSMA-A Antibody-Compound (XI)
PSMA-A Antibody-Compound (XI) payload
Undisclosed
PSMA-A Antibody-Compound (XI) linker
[12]
PSMA-A Antibody-Compound (XIV)
PSMA-A Antibody-Compound (XIV) payload
Undisclosed
PSMA-A Antibody-Compound (XIV) linker
[12]
PSMA-A Antibody-Compound (XIX)
PSMA-A Antibody-Compound (XIX) payload
Undisclosed
PSMA-A Antibody-Compound (XIX) linker
[12]
PSMA-A Antibody-Compound (XL)
PSMA-A Antibody-Compound (XL) payload
Undisclosed
PSMA-A Antibody-Compound (XL) linker
[12]
PSMA-A Antibody-Compound (XLI)
PSMA-A Antibody-Compound (XLI) payload
Undisclosed
PSMA-A Antibody-Compound (XLI) linker
[12]
PSMA-A Antibody-Compound (XLII)
PSMA-A Antibody-Compound (XLII) payload
Undisclosed
PSMA-A Antibody-Compound (XLII) linker
[12]
PSMA-A Antibody-Compound (XLIII)
PSMA-A Antibody-Compound (XLIII) payload
Undisclosed
PSMA-A Antibody-Compound (XLIII) linker
[12]
PSMA-A Antibody-Compound (XV)
PSMA-A Antibody-Compound (XV) payload
Undisclosed
PSMA-A Antibody-Compound (XV) linker
[12]
PSMA-A Antibody-Compound (XVI)
PSMA-A Antibody-Compound (XIX) payload
Undisclosed
PSMA-A Antibody-Compound (XIX) linker
[12]
PSMA-A Antibody-Compound (XVIII)
PSMA-A Antibody-Compound (XVIII) payload
Undisclosed
PSMA-A Antibody-Compound (XVIII) linker
[12]
PSMA-B Anti-ody
ADC Info ADC Name Payload Target Linker Ref
PSMA-B Antibody-Compound (Ie)
PSMA-B Antibody-Compound (Ie) payload
Undisclosed
PSMA-B Antibody-Compound (Ie) linker
[12]
PSMA-B Antibody-Compound (Ii)
PSMA-B Antibody-Compound (Ii) payload
Undisclosed
PSMA-B Antibody-Compound (Ii) linker
[12]
PSMA-B Antibody-Compound (X)
PSMA-B Antibody-Compound (X) payload
Undisclosed
PSMA-B Antibody-Compound (X) linker
[12]
PSMA-B Antibody-Compound (XI)
PSMA-B Antibody-Compound (XI) payload
Undisclosed
PSMA-B Antibody-Compound (XI) linker
[12]
PSMA-B Antibody-Compound (XIV)
PSMA-B Antibody-Compound (XIV) payload
Undisclosed
PSMA-B Antibody-Compound (XIV) linker
[12]
PSMA-B Antibody-Compound (XIX)
PSMA-B Antibody-Compound (XIX) payload
Undisclosed
PSMA-B Antibody-Compound (XIX) linker
[12]
PSMA-B Antibody-Compound (XL)
PSMA-B Antibody-Compound (XL) payload
Undisclosed
PSMA-B Antibody-Compound (XL) linker
[12]
PSMA-B Antibody-Compound (XLI)
PSMA-B Antibody-Compound (XLI) payload
Undisclosed
PSMA-B Antibody-Compound (XLI) linker
[12]
PSMA-B Antibody-Compound (XLII)
PSMA-B Antibody-Compound (XLII) payload
Undisclosed
PSMA-B Antibody-Compound (XLII) linker
[12]
PSMA-B Antibody-Compound (XLIII)
PSMA-B Antibody-Compound (XLIII) payload
Undisclosed
PSMA-B Antibody-Compound (XLIII) linker
[12]
PSMA-B Antibody-Compound (XV)
PSMA-B Antibody-Compound (XV) payload
Undisclosed
PSMA-B Antibody-Compound (XV) linker
[12]
PSMA-B Antibody-Compound (XVI)
PSMA-B Antibody-Compound (XIX) payload
Undisclosed
PSMA-B Antibody-Compound (XIX) linker
[12]
PSMA-B Antibody-Compound (XVIII)
PSMA-B Antibody-Compound (XVIII) payload
Undisclosed
PSMA-B Antibody-Compound (XVIII) linker
[12]
PSMA-C Anti-ody
ADC Info ADC Name Payload Target Linker Ref
PSMA-C Antibody-Compound (Ie)
PSMA-C Antibody-Compound (Ie) payload
Undisclosed
PSMA-C Antibody-Compound (Ie) linker
[12]
PSMA-C Antibody-Compound (Ii)
PSMA-C Antibody-Compound (Ii) payload
Undisclosed
PSMA-C Antibody-Compound (Ii) linker
[12]
PSMA-C Antibody-Compound (X)
PSMA-C Antibody-Compound (X) payload
Undisclosed
PSMA-C Antibody-Compound (X) linker
[12]
PSMA-C Antibody-Compound (XI)
PSMA-C Antibody-Compound (XI) payload
Undisclosed
PSMA-C Antibody-Compound (XI) linker
[12]
PSMA-C Antibody-Compound (XIV)
PSMA-C Antibody-Compound (XIV) payload
Undisclosed
PSMA-C Antibody-Compound (XIV) linker
[12]
PSMA-C Antibody-Compound (XIX)
PSMA-C Antibody-Compound (XIX) payload
Undisclosed
PSMA-C Antibody-Compound (XIX) linker
[12]
PSMA-C Antibody-Compound (XL)
PSMA-C Antibody-Compound (XL) payload
Undisclosed
PSMA-C Antibody-Compound (XL) linker
[12]
PSMA-C Antibody-Compound (XLI)
PSMA-C Antibody-Compound (XLI) payload
Undisclosed
PSMA-C Antibody-Compound (XLI) linker
[12]
PSMA-C Antibody-Compound (XLII)
PSMA-C Antibody-Compound (XLII) payload
Undisclosed
PSMA-C Antibody-Compound (XLII) linker
[12]
PSMA-C Antibody-Compound (XLIII)
PSMA-C Antibody-Compound (XLIII) payload
Undisclosed
PSMA-C Antibody-Compound (XLIII) linker
[12]
PSMA-C Antibody-Compound (XV)
PSMA-C Antibody-Compound (XV) payload
Undisclosed
PSMA-C Antibody-Compound (XV) linker
[12]
PSMA-C Antibody-Compound (XVI)
PSMA-C Antibody-Compound (XIX) payload
Undisclosed
PSMA-C Antibody-Compound (XIX) linker
[12]
PSMA-C Antibody-Compound (XVIII)
PSMA-C Antibody-Compound (XVIII) payload
Undisclosed
PSMA-C Antibody-Compound (XVIII) linker
[12]
Rosopatamab
ADC Info ADC Name Payload Target Linker Ref
Rosopatamab tetraxetan
Y90 (Radioactive isotope)
Undisclosed
Tetraxetan
[14]
Undisclosed; a humanized anti-PSMA antibody, https://aacrjournals.org/mct/article/23/12/1842/750247
ADC Info ADC Name Payload Target Linker Ref
ARX-517
Monomethyl auristatin F
Microtubule (MT)
Oxime-PEG3
[15]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
DAN-405
Cabazitaxel
Microtubule (MT)
Undisclosed
[16]
HDP-103
Alpha-amanitin
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Undisclosed
[17]
Anti-PSMA antibody-deBouganin fusion protein (Crescendo/Sesen Bio)
Undisclosed
Undisclosed
Undisclosed
[18]
Anti-PSMA antibody-drug conjugate (Protanbio)
Undisclosed
Undisclosed
Undisclosed
[19]
MMAE.VC.SA.617
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[20]
PSMA ADC (Jiangsu hengrui)
Undisclosed
Undisclosed
Undisclosed
[21]
Anti-PSMA antibody-drug conjugate
Undisclosed
Undisclosed
Undisclosed
[22]
CB-108
Undisclosed
Undisclosed
Undisclosed
[23]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.249838229; Fold-change: -0.00877963; Z-score: -0.021889
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.096826132; Fold-change: -0.310740876; Z-score: -3.221302421
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.10E-05; Fold-change: -2.979089199; Z-score: -2.551172216
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.86E-09; Fold-change: -1.662248488; Z-score: -5.929405602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.70E-33; Fold-change: -0.61194288; Z-score: -0.798812922
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001010549; Fold-change: 0.051048264; Z-score: 0.369624587
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.09E-06; Fold-change: 0.151595017; Z-score: 0.951000097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.570117985; Fold-change: -0.018537427; Z-score: -0.059519519
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.391151262; Fold-change: -0.077430161; Z-score: -0.523411826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.991740481; Fold-change: 0.045826995; Z-score: 0.314889352
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.979364998; Fold-change: -0.11747071; Z-score: -0.314138082
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.21E-05; Fold-change: 0.228501408; Z-score: 1.254505971
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.31E-08; Fold-change: 0.110268843; Z-score: 0.440829751
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.232960679; Fold-change: -0.014418156; Z-score: -0.044730924
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006754183; Fold-change: -0.308951815; Z-score: -0.813276667
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000129794; Fold-change: -0.385634438; Z-score: -0.345385456
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.05E-05; Fold-change: -0.403450792; Z-score: -0.661469795
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.19E-05; Fold-change: -0.119658023; Z-score: -0.342709861
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.086034272; Fold-change: -0.285334233; Z-score: -1.097146733
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015792328; Fold-change: 0.028381216; Z-score: 0.1033747
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.52E-08; Fold-change: 0.089010334; Z-score: 0.42900282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.027391774; Fold-change: 0.86210157; Z-score: 0.882284737
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.41E-09; Fold-change: 0.09214561; Z-score: 0.419226668
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.088551002; Fold-change: -0.172232972; Z-score: -1.214646909
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.62E-19; Fold-change: -0.228680422; Z-score: -0.491123174
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003843658; Fold-change: -0.169896035; Z-score: -0.49235945
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113655822; Fold-change: -0.187295983; Z-score: -0.832702695
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.585731932; Fold-change: -0.254759947; Z-score: -0.890184685
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.195559494; Fold-change: -0.149953683; Z-score: -0.492204851
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.39E-08; Fold-change: -0.34946057; Z-score: -0.83976276
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.079631242; Fold-change: 0.145631797; Z-score: 0.540877282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.40E-09; Fold-change: 2.075991168; Z-score: 2.207145965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.97E-09; Fold-change: 1.146565091; Z-score: 7.224479893
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.10E-07; Fold-change: -0.455828885; Z-score: -3.170301208
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.96E-08; Fold-change: 0.219047778; Z-score: 0.767679927
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.151476383; Fold-change: 0.082023481; Z-score: 0.258114041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.410664414; Fold-change: 9.94E-05; Z-score: 0.001480263
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00414592; Fold-change: -0.061330166; Z-score: -0.247066784
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.447616605; Fold-change: -0.165320148; Z-score: -0.529651608
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.479672363; Fold-change: 0.095868977; Z-score: 0.289201596
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.128678186; Fold-change: 0.052720069; Z-score: 0.451625936
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037282829; Fold-change: 0.070101445; Z-score: 0.14465812
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.755078416; Fold-change: 0.080376245; Z-score: 0.240440156
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.368485796; Fold-change: -0.174194657; Z-score: -0.811465957
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.685815693; Fold-change: -0.022433484; Z-score: -0.12448102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.026135578; Fold-change: -0.302510192; Z-score: -1.380010032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.568562127; Fold-change: -0.029925823; Z-score: -0.147390282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.468469261; Fold-change: -0.154281991; Z-score: -0.556977739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000134177; Fold-change: -0.311489351; Z-score: -1.142208278
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.288832525; Fold-change: 0.026312297; Z-score: 0.154763556
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.886264273; Fold-change: -0.101277997; Z-score: -0.307974414
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.49905218; Fold-change: 0.116483995; Z-score: 0.450255789
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.069161059; Fold-change: 0.143720708; Z-score: 0.834491174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.109576669; Fold-change: 0.067875553; Z-score: 0.255904434
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.34E-06; Fold-change: 0.192879144; Z-score: 0.58846754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.63003871; Fold-change: -0.019564358; Z-score: -0.118415074
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.070264574; Fold-change: -0.220696969; Z-score: -2.304229763
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.333424478; Fold-change: 0.176539723; Z-score: 0.208508726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.634386765; Fold-change: -0.036825257; Z-score: -0.174896193
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.744603375; Fold-change: 0.2163258; Z-score: 0.309289134
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.75755819; Fold-change: -0.029523339; Z-score: -0.240233629
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.400176687; Fold-change: 0.089490213; Z-score: 0.288049817
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.686583846; Fold-change: 0.020437627; Z-score: 0.201477545
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.977384748; Fold-change: -0.183272691; Z-score: -0.500718405
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.294616274; Fold-change: 0.041153475; Z-score: 0.146825583
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.159824677; Fold-change: 0.132661974; Z-score: 0.734525216
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01460039; Fold-change: 0.157826177; Z-score: 0.644900651
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.929659249; Fold-change: -0.020737966; Z-score: -0.066430891
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000731507; Fold-change: -0.191861749; Z-score: -0.194341433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.365399979; Fold-change: 0.06628046; Z-score: 0.316351433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.346173915; Fold-change: -0.100033947; Z-score: -0.339626333
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.038484715; Fold-change: 0.097508092; Z-score: 0.234246456
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.572886838; Fold-change: 0.036495697; Z-score: 0.175130212
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002655423; Fold-change: 0.275372702; Z-score: 2.073906804
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.9310993; Fold-change: -0.033342569; Z-score: -0.103119127
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.791275166; Fold-change: 0.082156317; Z-score: 0.169981755
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.112255346; Fold-change: 0.074736406; Z-score: 0.326300353
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.87E-07; Fold-change: 0.222316539; Z-score: 0.707128102
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 9.54E-15; Fold-change: 0.563055396; Z-score: 1.158212728
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.618036859; Fold-change: 0.030257251; Z-score: 0.059323873
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.179172525; Fold-change: 0.11706516; Z-score: 0.259325218
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.947985327; Fold-change: -0.100299384; Z-score: -0.71130584
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.977542363; Fold-change: -0.011290647; Z-score: -0.064645517
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.156469445; Fold-change: 0.068639543; Z-score: 0.399670876
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.662418918; Fold-change: -0.032565498; Z-score: -0.122118824
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.783912884; Fold-change: 0.109323559; Z-score: 0.26258022
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.478849046; Fold-change: -0.073387902; Z-score: -0.335159638
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.896294496; Fold-change: -0.057871945; Z-score: -0.400777863
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.997905875; Fold-change: -0.060686388; Z-score: -0.178552465
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.41752326; Fold-change: -0.036931716; Z-score: -0.313013849
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.609407244; Fold-change: -0.138138524; Z-score: -0.474153284
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02600897; Fold-change: 0.060284347; Z-score: 0.286782876
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001455673; Fold-change: -0.593840622; Z-score: -1.657925726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.461256759; Fold-change: 0.146970416; Z-score: 1.050452288
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000269115; Fold-change: -0.561019193; Z-score: -1.197704866
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.550903291; Fold-change: -0.08797114; Z-score: -0.196617409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.887382058; Fold-change: 0.157646343; Z-score: 0.391419506
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.139464317; Fold-change: 0.177885709; Z-score: 0.788133101
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.137861466; Fold-change: 0.1554891; Z-score: 0.676511615
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004111472; Fold-change: -0.020564864; Z-score: -0.045703443
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.43E-11; Fold-change: 0.332323397; Z-score: 0.634446245
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.520480404; Fold-change: -0.26413761; Z-score: -0.666866039
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.77E-11; Fold-change: -0.545897606; Z-score: -0.797402761
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838482666; Fold-change: -0.1195786; Z-score: -0.297551839
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.58277558; Fold-change: -0.059602929; Z-score: -0.771397697
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.79259956; Fold-change: -0.198528833; Z-score: -1.544607995
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.25749816; Fold-change: 0.465514238; Z-score: 1.087936651
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.48227528; Fold-change: 0.005055487; Z-score: 0.024093353
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.111872357; Fold-change: 0.101748331; Z-score: 0.634103547
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.267333413; Fold-change: 0.059695117; Z-score: 0.341757371
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.611583385; Fold-change: 0.083163244; Z-score: 0.178554911
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.155434646; Fold-change: -0.075353723; Z-score: -0.908178014
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.338979207; Fold-change: 0.191723474; Z-score: 0.994937896
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.456350805; Fold-change: 0.200888398; Z-score: 0.905906176
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.778571138; Fold-change: 0.06055654; Z-score: 0.158405739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.98450158; Fold-change: 0.044359526; Z-score: 0.239488581
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.931473122; Fold-change: 0.009865986; Z-score: 0.073661494
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.913851328; Fold-change: 0.012779145; Z-score: 0.107138464
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.217206241; Fold-change: 0.128885026; Z-score: 1.210939674
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.306551985; Fold-change: -0.12281283; Z-score: -0.497976518
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.082281287; Fold-change: 0.069715035; Z-score: 0.328480907
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.616413035; Fold-change: 0.025090147; Z-score: 0.094675194
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.484353326; Fold-change: 0.012048498; Z-score: 0.123603568
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.503074942; Fold-change: -0.036331277; Z-score: -0.053768054
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.567015415; Fold-change: -0.015895869; Z-score: -0.088861796
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.048234529; Fold-change: 0.219100255; Z-score: 1.701126135
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.450237744; Fold-change: -0.006618677; Z-score: -0.035941645
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.185075371; Fold-change: 0.053550705; Z-score: 0.44743947
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.216452188; Fold-change: -0.131186875; Z-score: -0.886404213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Monoclonal antibody 7E11 C5-selenocystamine conjugate; 29 Apr 2002.
Ref 2 Characterization of Site-Specifically Conjugated Monomethyl Auristatin E- and Duocarmycin-Based Anti-PSMA Antibody-Drug Conjugates for Treatment of PSMA-Expressing Tumors. J Nucl Med. 2018 Mar;59(3):494-501. doi: 10.2967/jnumed.117.196279. Epub 2017 Nov 16.
Ref 3 Antibody drug conjugates of cleavable amino-alkyl and aryl maytansinoids. Bioorg Med Chem. 2018 May 15;26(9):2271-2279. doi: 10.1016/j.bmc.2018.02.025. Epub 2018 Feb 21.
Ref 4 Evaluation of 111In-DOTA-5D3, a Surrogate SPECT Imaging Agent for Radioimmunotherapy of Prostate-Specific Membrane Antigen. J Nucl Med. 2019 Mar;60(3):400-406. doi: 10.2967/jnumed.118.214403. Epub 2018 Sep 20.
Ref 5 Duocarmycin-based antibody-drug conjugates as an emerging biotherapeutic entity for targeted cancer therapy: Pharmaceutical strategy and clinical progress. Drug Discov Today. 2021 Aug;26(8):1857-1874. doi: 10.1016/j.drudis.2021.06.012. Epub 2021 Jul 3.
Ref 6 Amatoxin antibody-drug conjugates and uses thereof; 2020-10-29.
Ref 7 In Vitro Evaluation of Humanized/De-immunized Anti-PSMA Immunotoxins for the Treatment of Prostate Cancer. Anticancer Res. 2018 Jan;38(1):61-69. doi: 10.21873/anticanres.12192.
Ref 8 Site-specific conjugation of linker drugs to antibodies and resulting adcs.
Ref 9 Anti-PSMA (124)I-scFvD2B as a new immuno-PET tool for prostate cancer: preclinical proof of principle. J Exp Clin Cancer Res. 2019 Jul 23;38(1):326. doi: 10.1186/s13046-019-1325-6.
Ref 10 Antibody-drug conjugates targeting prostate-specific membrane antigen. Front Biosci (Landmark Ed). 2014 Jan 1;19(1):12-33. doi: 10.2741/4193.
Ref 11 CMB-401
Ref 12 Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 13 Phase 1/2 multiple ascending dose trial of the prostate-specific membrane antigen-targeted antibody drug conjugate MLN2704 in metastatic castration-resistant prostate cancer. Urol Oncol. 2016 Dec;34(12):530.e15-530.e21.
Ref 14 ADC review ROSOPATAMAB TETRAXETAN
Ref 15 Preclinical characterization of ARX517, a next-generation anti-PSMA antibody drug conjugate for the treatment of metastatic castration-resistant prostate cancer. Cancer Res (2023) 83 (7_Supplement): 3997.
Ref 16 Dantari biotechnology company product pipeline
Ref 17 Heidelberg pharma product pipeline
Ref 18 Engineering and characterization of anti-PSMA humabody-deBouganin fusion proteins. Cancer Res (2018) 78 (13_Supplement): 5770.
Ref 19 Introduction to basic information on anti PRLR anti-PSMA antibody-drug conjugate(Protanbio).
Ref 20 Old Drug, New Delivery Strategy: MMAE Repackaged. Int J Mol Sci. 2023 May 10;24(10):8543. doi: 10.3390/ijms24108543.
Ref 21 Introduction to basic information on ADC drug PSMA ADC (Jiangsu hengrui)
Ref 22 Introduction to basic information on ADC drug Anti-PSMA antibody-drug conjugates(Medarex)
Ref 23 Multifunctional biologics for targeted T-cell therapy based on in vivo matured fully human VH domains. Cancer Res (2018) 78 (13_Supplement): 5766.