Antibody Information

General Information of This Antibody
Antibody ID
ANI0CHVGY
Antibody Name
MLN591
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG
Antigen Name
Glutamate carboxypeptidase 2 (FOLH1)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGPEVKKPGATVKISCKTSGYTFTEYTIHWVKQAPGKGLEWIGNINPNNGGTTY
NQKFEDKATLTVDKSTDTAYMELSSLRSEDTAVYYCAAGWNFDYWGQGTLLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL
FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSTSVGDRVTLTCKASQDVGTAVDWYQQKPGPSPKLLIYWASTRHTGIPS
RFSGSGSGTDFTLTISSLQPEDFADYYCQQYNSYPLTFGPGTKVDIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
MLN2704 [Phase 1/2 (discontinued)]
 ADC Info 
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
The study includes patients with histologically confirmed prostate adenocarcinoma showing progression via physical exam, imaging, or rising PSA despite castrate testosterone levels. Continuous LHRH analog therapy is required if initiated before screening, while prior anti-androgens require progression post-withdrawal. Effective barrier contraception is mandatory.

   Click to Show/Hide
Administration Dosage
Twenty-three patients received MLN2704 at doses of 18 to 343 mg/m2. Eighteen of these patients received ≥ three doses at 4-week intervals.
Related Clinical Trial
NCT Number NCT00052000  Clinical Status PHASE1
Clinical Description
A Phase 1 Single Ascending Dose Trial of MLN2704 (DM1 Conjugated Monoclonal Antibody MLN591) in Subjects With Metastatic Androgen Independent Prostate Cancer
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients require histologically confirmed metastatic prostate adenocarcinoma, age &ge;18 years, disease progression despite castrate testosterone (<50 ng/dL), and continuous LHRH analog therapy unless surgically castrated. Key exclusions include testosterone >50 ng/dL, recent corticosteroids/chemotherapy, CNS metastases, neuropathy >Grade 2, abnormal labs (platelets <100K/mm <sup>3</sup>, ANC <1.5K/mm <sup>3</sup>, Hct <27%), active infections, severe cardiac/respiratory/renal/hepatic conditions, or limited life expectancy (<6 months).

   Click to Show/Hide
Administration Dosage
A total of 62 patients received MLN2704 at ascending doses on 4 schedules: weekly (60, 84, 118, and 165 mg/m2; 12 patients); every 2 weeks (120, 168, 236, and 330 mg/m2; 15 patients); every 3 weeks (330 and 426 mg/m2; 18 patients); and on days 1 and 15 of a 6-week schedule (6-week cycle, 330 mg/m2; 17 patients).
Related Clinical Trial
NCT Number NCT00070837  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase 1/2 Dose Escalation Trial of Multiple Doses of MLN2704 (DM1 Conjugated Monoclonal Antibody MLN591) in Subjects With Metastatic Androgen-Independent Prostate Cancer
References
Ref 1 A Trial of MLN2704 in Subjects With Metastatic Androgen Independent Prostate Cancer
Ref 2 Phase 1/2 multiple ascending dose trial of the prostate-specific membrane antigen-targeted antibody drug conjugate MLN2704 in metastatic castration-resistant prostate cancer