Antibody Information
General Information of This Antibody (ID: ANI0IXUSQ)
| Antibody Name | Anti-PSMA-D265C |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG |
|||||
| Antigen Name | Glutamate carboxypeptidase 2 (FOLH1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYTFTYFDINWLRQAPGQGLEWMGGISPGDSNVNY
AQKFQGRVTLTIDTSTSTAYMELSSLRSEDTAVYYCARDGNFPYYAMDSWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVCVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIVMTQSPLSLPVTPGEPASISCRSSQSLVHSSGQTYLHWYQQKPGQSPQLLIYTVSNRA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGTYYCSQSTHVPTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-PSMA-D265C-30.2371 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
14 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
71 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.1699 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
22 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.11 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.2060 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
32 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.19 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.2347 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
43 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.16 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.2867 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
47 pM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.49 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.0880 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.11 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.57 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
Anti-PSMA-D265C-30.2115 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.27 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | LNCaP cells | CVCL_0395 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.36 nM
|
Positive PSMA expression (PSMA +++/++) | ||
| Method Description |
The cytotoxic activity in vitro of ADCs, which are comprising an anti-PSMA antibody carrying a D265C mutation conjugated tostructurally different amanitin derivatives via its D265C residue was tested on LNCaP cells and 22RV1 cells.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
