Antigen Information
General Information of This Antigen
| Antigen ID | TAR0XFYLU |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Trophoblast glycoprotein (TPBG) |
|||||
| Gene Name | TPBG |
|||||
| Gene ID | ||||||
| Synonym | 5T4; 5T4 oncofetal antigen;5T4 oncofetal trophoblast glycoprotein;M6P1;Wnt-activated inhibitory factor 1 |
|||||
| Sequence |
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV Click to Show/Hide
|
|||||
| Function |
May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
5T4_0108
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
MEDI-0641 |
5T4-PBD |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala-PABC |
[1] |
Anti-5T4 mAb H8 P41C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2015177360A1 ADC-H8-HC41 |
seco-DUBA |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer |
[2] |
Anti-5T4 mAb H8 S40C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2015177360A1 ADC-H8-HC40 |
seco-DUBA |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer |
[2] | |
WO2015177360A1 ADC-H8-HC40-mcMMAF |
Monomethyl auristatin F |
Microtubule (MT) |
Maleimido-caproyl |
[2] | |
WO2015177360A1 ADC-H8-HC40-vcMMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[2] |
Anti-5T4 mAb H8 wt
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2015177360A1 ADC-H8-wt |
seco-DUBA |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer |
[2] | |
WO2015177360A1 ADC-H8-wt-mcMMAF |
Monomethyl auristatin F |
Microtubule (MT) |
Maleimido-caproyl |
[2] |
Anti-5T4 mAb m603
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
M603-SN38 DAR4 |
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
[3] | |
M603-SN38 DAR6 |
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
[3] | |
M603-SN38 DAR8 |
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
[3] |
Anti-5T4 n501 (nanobody)
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
N501-SN38 |
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
[3] |
Anti-5T4 scFv-Fc Anti-ody
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ASN-004 |
Auristatin F hydroxypropylamide (AF-HPA) |
Microtubule (MT) |
Fleximer polymer |
[4] |
PF-06281192
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
PF-06263507 |
Monomethyl auristatin F |
Microtubule (MT) |
Maleimido-caproyl |
[5] |
SYD1594
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SYD-1875 |
seco-DUBA |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG2-Val-Cit-PABA-Cyclization Spacer |
[6] |
ZV05
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ZV-0501 |
Monomethyl auristatin F |
Microtubule (MT) |
Maleimido-caproyl |
[7] | |
ZV-0508 |
Duostatin 5 |
Human Deoxyribonucleic acid (hDNA) |
C-Lock-ANN tri-peptide |
[7] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
JK-06 |
Monomethyl auristatin E |
Microtubule (MT) |
Undisclosed |
[8] | |
TUB-030 |
Exatecan |
DNA topoisomerase 1 (TOP1) |
A cleavable linker |
[9] | |
XB-010 |
Monomethyl auristatin E |
Microtubule (MT) |
RED-601 |
[10] | |
5T4-FC-Mc-Lys-MMETA |
Undisclosed |
Undisclosed |
Undisclosed |
[11] | |
Antibody-drug conjugate (Zova Biotherapeutics) |
Undisclosed |
Undisclosed |
Undisclosed |
[12] | |
Anti-TPBG antibody-drug conjugate (XDCExplorer) |
Undisclosed |
Undisclosed |
Undisclosed |
[13] | |
CME-548 |
Undisclosed |
Undisclosed |
Undisclosed |
[14] | |
A1-121-PHC-D-2 |
Undisclosed |
Undisclosed |
Undisclosed |
[15] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Bacterial infection of gingival | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.15E-09; Fold-change: -0.252168156; Z-score: -0.818772993 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Brainstem | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.084943384; Fold-change: -0.835601393; Z-score: -3.226819249 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.080778263; Fold-change: 0.204222915; Z-score: 0.378686156 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem | |
| The Specific Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.75271789; Fold-change: -0.160911797; Z-score: -0.659556837 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Nervous | |
| The Specific Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.02659256; Fold-change: -0.568394588; Z-score: -0.609497671 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Polycythemia vera | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000176009; Fold-change: 0.104889622; Z-score: 0.889065598 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Whole blood | |
| The Specific Disease | Myelofibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.054207692; Fold-change: 0.338726806; Z-score: 2.751735784 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myelodysplastic syndromes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.53E-05; Fold-change: 0.144451425; Z-score: 0.522533621 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000508315; Fold-change: 1.308734715; Z-score: 5.223512545 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Tonsil | |
| The Specific Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.373361939; Fold-change: -0.194979866; Z-score: -0.668823314 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric | |
| The Specific Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.005849977; Fold-change: 0.801456865; Z-score: 4.77544979 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.54E-07; Fold-change: 0.55663403; Z-score: 1.421715032 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon | |
| The Specific Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.711429525; Fold-change: 0.017501381; Z-score: 0.062497696 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.49E-05; Fold-change: -0.160616479; Z-score: -0.400416226 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pancreas | |
| The Specific Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.92E-06; Fold-change: 0.868717823; Z-score: 1.685777053 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.94E-18; Fold-change: 1.307518284; Z-score: 1.889921366 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.309093338; Fold-change: -0.197008544; Z-score: -0.76920504 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.007064737; Fold-change: -0.378301563; Z-score: -1.242887842 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.848115123; Fold-change: -0.172715086; Z-score: -0.538478675 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.73E-130; Fold-change: 1.071075901; Z-score: 3.463595206 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.39E-66; Fold-change: 1.034604435; Z-score: 2.767026423 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Melanoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.296625314; Fold-change: -0.115419449; Z-score: -0.115217534 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Sarcoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.58E-201; Fold-change: 2.250361842; Z-score: 5.37389891 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.74E-05; Fold-change: 2.306305611; Z-score: 11.31646359 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Breast | |
| The Specific Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.21E-24; Fold-change: 0.519318253; Z-score: 0.816189992 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.79E-06; Fold-change: 0.45861724; Z-score: 0.660479511 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Ovarian | |
| The Specific Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.018016952; Fold-change: 0.510474842; Z-score: 0.795724358 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.58E-07; Fold-change: -1.583442154; Z-score: -2.739820588 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Cervical | |
| The Specific Disease | Cervical cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.968314802; Fold-change: -0.037786005; Z-score: -0.070248686 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Uterine cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.85E-05; Fold-change: -0.29146027; Z-score: -0.386085717 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.35E-06; Fold-change: -1.247144156; Z-score: -7.609845909 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Prostate | |
| The Specific Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.129998817; Fold-change: 0.154798711; Z-score: 0.173673824 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.89E-07; Fold-change: -0.928983466; Z-score: -4.356395579 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Uvea | |
| The Specific Disease | Retinoblastoma tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001335526; Fold-change: 1.398589264; Z-score: 2.146716802 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Thyroid | |
| The Specific Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.56E-06; Fold-change: 0.097027811; Z-score: 0.286624661 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.57E-10; Fold-change: 0.330424654; Z-score: 1.112860764 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adrenal cortex | |
| The Specific Disease | Adrenocortical carcinoma | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.000343796; Fold-change: 0.094781342; Z-score: 0.699487922 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Head and neck | |
| The Specific Disease | Head and neck cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.63E-10; Fold-change: 0.745677383; Z-score: 1.062952014 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary gonadotrope tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.015414849; Fold-change: -0.555010934; Z-score: -1.00575297 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000490778; Fold-change: -0.863747593; Z-score: -1.498166887 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.651791402; Fold-change: -0.001536355; Z-score: -0.004824651 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Lupus erythematosus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.063495868; Fold-change: -0.086524048; Z-score: -0.296504152 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral monocyte | |
| The Specific Disease | Autoimmune uveitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.443096156; Fold-change: 0.246631637; Z-score: 2.000413296 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.045658745; Fold-change: 0.025065715; Z-score: 0.052965442 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Superior temporal cortex | |
| The Specific Disease | Schizophrenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008049438; Fold-change: -0.2988875; Z-score: -0.907762592 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Spinal cord | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.420906294; Fold-change: 0.070038976; Z-score: 0.091675279 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Plasmacytoid dendritic cells | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.993139296; Fold-change: 0.02243078; Z-score: 0.15113255 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peritumoral cortex | |
| The Specific Disease | Epilepsy | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.031994072; Fold-change: -0.848884055; Z-score: -2.425998641 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Cardioembolic Stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.240437933; Fold-change: -0.10192292; Z-score: -0.265810425 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Ischemic stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.076221683; Fold-change: -0.015222217; Z-score: -0.032601976 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | White matter | |
| The Specific Disease | HIV | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.117030538; Fold-change: -0.436582891; Z-score: -0.589901489 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Influenza | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.062275896; Fold-change: -0.060989418; Z-score: -2.216158267 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Chronic hepatitis C | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.009501308; Fold-change: -0.209058148; Z-score: -1.046987254 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Sepsis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.06E-05; Fold-change: 0.093826632; Z-score: 0.612087307 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Septic shock | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.742260641; Fold-change: -0.030253768; Z-score: -0.161179975 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Pediatric respiratory syncytial virus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.38208161; Fold-change: -0.028209959; Z-score: -0.236473842 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Essential hypertension | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.486286005; Fold-change: 0.05908602; Z-score: 1.746230708 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myocardial infarction | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002211721; Fold-change: -0.46182098; Z-score: -0.628321449 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Coronary artery disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003397097; Fold-change: 0.250679366; Z-score: 2.080163063 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Calcified aortic valve | |
| The Specific Disease | Aortic stenosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.793657907; Fold-change: -0.22472871; Z-score: -0.291067987 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arteriosclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.605987407; Fold-change: -0.016871095; Z-score: -0.072864394 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Intracranial artery | |
| The Specific Disease | Aneurysm | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.060361744; Fold-change: 0.49765359; Z-score: 1.047754467 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Immunodeficiency | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003937903; Fold-change: -0.240843128; Z-score: -1.797094063 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Hyperplastic tonsil | |
| The Specific Disease | Apnea | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.025635635; Fold-change: -0.633096886; Z-score: -1.91401254 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Olive pollen allergy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.01208684; Fold-change: 0.471532131; Z-score: 2.772711069 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Sinus mucosa | |
| The Specific Disease | Chronic rhinosinusitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.728894786; Fold-change: 0.018408011; Z-score: 0.065397307 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.309251393; Fold-change: -0.048859666; Z-score: -0.150736608 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Small airway epithelium | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.112941053; Fold-change: -0.084013776; Z-score: -0.209816929 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal and bronchial airway | |
| The Specific Disease | Asthma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.12E-08; Fold-change: 0.511747888; Z-score: 0.724115041 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal Epithelium | |
| The Specific Disease | Human rhinovirus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.896783309; Fold-change: 0.017204603; Z-score: 0.089289613 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Idiopathic pulmonary fibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001805509; Fold-change: 0.885760838; Z-score: 3.832312146 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Periodontal disease | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.93E-09; Fold-change: -0.228745667; Z-score: -0.713270428 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric antrum | |
| The Specific Disease | Eosinophilic gastritis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.120572621; Fold-change: -0.285198336; Z-score: -0.999141942 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver failure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.084762567; Fold-change: 0.296223801; Z-score: 0.863834692 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon mucosal | |
| The Specific Disease | Ulcerative colitis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.66531014; Fold-change: -0.01787416; Z-score: -0.046663913 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Irritable bowel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.097092562; Fold-change: -0.052224837; Z-score: -0.204139422 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Atopic dermatitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.36E-06; Fold-change: 0.458451391; Z-score: 1.841985779 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Psoriasis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.90E-50; Fold-change: 1.160346517; Z-score: 3.599145672 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.47E-05; Fold-change: 0.39305947; Z-score: 0.964379301 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Vitiligo | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.48694408; Fold-change: -0.021200942; Z-score: -0.098880672 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin from scalp | |
| The Specific Disease | Alopecia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.953931218; Fold-change: 0.018221863; Z-score: 0.049364336 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Sensitive skin | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.067027601; Fold-change: 0.416371298; Z-score: 3.401156193 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Osteoarthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.058964794; Fold-change: 0.897953563; Z-score: 0.979374114 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthropathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.357664016; Fold-change: 0.060658871; Z-score: 0.249328692 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.815048047; Fold-change: -0.046146338; Z-score: -0.10272899 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Rheumatoid arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00156278; Fold-change: 0.784932764; Z-score: 1.522539596 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pheripheral blood | |
| The Specific Disease | Ankylosing spondylitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.365258368; Fold-change: -0.018970547; Z-score: -0.032563422 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Osteoporosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012831047; Fold-change: -0.494163703; Z-score: -1.8784077 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Endometriosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.039085975; Fold-change: -0.625258618; Z-score: -0.958331967 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Interstitial cystitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000343197; Fold-change: -0.59372441; Z-score: -2.7732518 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Myometrium | |
| The Specific Disease | Preterm birth | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.214943213; Fold-change: -0.666621571; Z-score: -4.075028295 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Acute myelocytic leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.38E-28; Fold-change: 0.333930494; Z-score: 1.323537291 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00149649; Fold-change: 0.140227582; Z-score: 0.690471927 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.150417068; Fold-change: 0.066587117; Z-score: 0.816217737 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Oral | |
| The Specific Disease | Oral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.99E-11; Fold-change: 1.232234477; Z-score: 2.106299674 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.24E-13; Fold-change: 0.463904607; Z-score: 0.9808948 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Esophagus | |
| The Specific Disease | Esophagal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.560578164; Fold-change: -0.0342049; Z-score: -0.043645289 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Rectal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.750668346; Fold-change: 0.047833985; Z-score: 0.152533681 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.128748104; Fold-change: -0.0936677; Z-score: -0.492748171 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Skin cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.32E-11; Fold-change: -0.409935806; Z-score: -0.829650171 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.09E-38; Fold-change: -0.957690525; Z-score: -1.916252299 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Kidney | |
| The Specific Disease | Renal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.20305188; Fold-change: 0.385861874; Z-score: 0.518157018 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.17E-18; Fold-change: 0.680102541; Z-score: 1.39269063 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Urothelium | |
| The Specific Disease | Ureter cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.144504184; Fold-change: 0.079754428; Z-score: 0.368711223 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adipose | |
| The Specific Disease | Simpson golabi behmel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.3569747; Fold-change: -0.163544476; Z-score: -1.082575245 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Perituberal | |
| The Specific Disease | Tuberous sclerosis complex | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.464642901; Fold-change: 0.096812808; Z-score: 0.232194614 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Anemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.444802064; Fold-change: -0.020850375; Z-score: -0.051141775 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Sickle cell disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.056722989; Fold-change: 0.05036927; Z-score: 0.542040403 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocythemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.542248037; Fold-change: 0.015847733; Z-score: 0.133615038 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Scleroderma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.433108441; Fold-change: 0.005128539; Z-score: 0.027460939 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Salivary gland | |
| The Specific Disease | Sjogren syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.141848292; Fold-change: 0.114841313; Z-score: 0.527690861 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.02E-05; Fold-change: 0.354646242; Z-score: 5.848214824 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Behcet disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.141609771; Fold-change: 0.141105454; Z-score: 0.667585634 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autosomal dominant monocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.220540038; Fold-change: 0.019426426; Z-score: 0.178321967 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.148952718; Fold-change: 0.083237632; Z-score: 0.686332666 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Vastus lateralis muscle | |
| The Specific Disease | Polycystic ovary syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.554761913; Fold-change: 0.060020576; Z-score: 0.320918929 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Subcutaneous Adipose | |
| The Specific Disease | Obesity | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.037926572; Fold-change: 0.135537899; Z-score: 0.471235393 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Biceps muscle | |
| The Specific Disease | Pompe disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.009208854; Fold-change: 0.365284463; Z-score: 1.666231001 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Batten disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.917090135; Fold-change: 0.030034283; Z-score: 0.098216655 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autism | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.316086773; Fold-change: 0.000620859; Z-score: 0.004323864 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Anxiety disorder | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.633310034; Fold-change: -0.02164747; Z-score: -0.05756314 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Substantia nigra | |
| The Specific Disease | Parkinson disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.0066221; Fold-change: -0.716391721; Z-score: -1.119596553 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Huntington disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.455403329; Fold-change: 0.029251014; Z-score: 0.215825109 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Entorhinal cortex | |
| The Specific Disease | Alzheimer disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.728862158; Fold-change: -0.089748341; Z-score: -0.10147077 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Seizure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.148407767; Fold-change: -0.096661678; Z-score: -0.423363706 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.482999304; Fold-change: -0.259821866; Z-score: -0.585600933 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Cervical spinal cord | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012166089; Fold-change: -0.348425618; Z-score: -0.688136068 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Muscular atrophy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.06E-08; Fold-change: 0.955056363; Z-score: 3.189868256 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Myopathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001128363; Fold-change: 0.383675298; Z-score: 1.509713827 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
References
