Antigen ID	TAR0KQONX
Antigen Name	Tumor necrosis factor receptor superfamily member 17 (TNFRSF17)
Gene Name	TNFRSF17
Gene ID	608
Synonym	BCM; BCMA; B-cell maturation protein;CD_antigen=CD269
Sequence	MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR     Click to Show/Hide
Function	Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.     Click to Show/Hide
Uniprot Entry	TNR17_HUMAN
HGNC ID	HGNC:11913
KEGG ID	hsa:608

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA 15B2GL-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA 15B2GL-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA 15B2WT-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA 15B2WT-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA I09-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA I09-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA J6M0-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA J6M0-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA L15-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA L15-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA M02-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA M02-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA N22-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA N22-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA P10-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]
ADC Info	Anti-BCMA P10-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-BCMA R347-SG3249	SG3199	Human Deoxyribonucleic acid (hDNA)	CL2A	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AMG-224	Mertansine DM1	Microtubule (MT)	Noncleavable linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	BCMA-A Antibody-Compound (X)	BCMA-A Antibody-Compound (X) payload	Undisclosed	BCMA-A Antibody-Compound (X) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XI)	BCMA-A Antibody-Compound (XI) payload	Undisclosed	BCMA-A Antibody-Compound (XI) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XIV)	BCMA-A Antibody-Compound (XIV) payload	Undisclosed	BCMA-A Antibody-Compound (XIV) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XVIII)	BCMA-A Antibody-Compound (XVIII) payload	Undisclosed	BCMA-A Antibody-Compound (XVIII) linker	[3]
ADC Info	BCMA-A Antibody-Compound (Ie)	BCMA-A Antibody-Compound (Ie) payload	Undisclosed	BCMA-A Antibody-Compound (Ie) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XIX)	BCMA-A Antibody-Compound (XIX) payload	Undisclosed	BCMA-A Antibody-Compound (XIX) linker	[3]
ADC Info	BCMA-A Antibody-Compound (Ii)	BCMA-A Antibody-Compound (Ii) payload	Undisclosed	BCMA-A Antibody-Compound (Ii) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XLI)	BCMA-A Antibody-Compound (XLI) payload	Undisclosed	BCMA-A Antibody-Compound (XLI) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XVI)	BCMA-A Antibody-Compound (XIX) payload	Undisclosed	BCMA-A Antibody-Compound (XIX) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XL)	BCMA-A Antibody-Compound (XL) payload	Undisclosed	BCMA-A Antibody-Compound (XL) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XLII)	BCMA-A Antibody-Compound (XLII) payload	Undisclosed	BCMA-A Antibody-Compound (XLII) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XV)	BCMA-A Antibody-Compound (XV) payload	Undisclosed	BCMA-A Antibody-Compound (XV) linker	[3]
ADC Info	BCMA-A Antibody-Compound (XLIII)	BCMA-A Antibody-Compound (XLIII) payload	Undisclosed	BCMA-A Antibody-Compound (XLIII) linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MEDI-2228	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Belantamab mafodotin	Monomethyl auristatin F	Microtubule (MT)	Maleimido-caproyl	[5]
ADC Info	Belantamab-Compound (Ia)	NeoDegrader P1	Protein cereblon (CRBN)	Belantamab-Compound (Ia) linker	[6]
ADC Info	Belantamab-Compound (X)	Belantamab-Compound (X) payload	Undisclosed	Belantamab-Compound (X) linker	[3]
ADC Info	Belantamab-Compound (XI)	Belantamab-Compound (XI) payload	Undisclosed	Belantamab-Compound (XI) linker	[3]
ADC Info	Belantamab-Compound (XIV)	Belantamab-Compound (XIV) payload	Undisclosed	Belantamab-Compound (XIV) linker	[3]
ADC Info	Belantamab-Compound (XVIII)	Belantamab-Compound (XVIII) payload	Undisclosed	Belantamab-Compound (XVIII) linker	[3]
ADC Info	Belantamab-Compound (Ie)	Belantamab-Compound (Ie) payload	Undisclosed	Belantamab-Compound (Ie) linker	[3]
ADC Info	Belantamab-Compound (XIX)	Belantamab-Compound (XIX) payload	Undisclosed	Belantamab-Compound (XIX) linker	[3]
ADC Info	Belantamab-Compound (Ii)	Belantamab-Compound (Ii) payload	Undisclosed	Belantamab-Compound (Ii) linker	[3]
ADC Info	Belantamab-Compound (XLI)	Belantamab-Compound (XLI) payload	Undisclosed	Belantamab-Compound (XLI) linker	[3]
ADC Info	Belantamab-Compound (XVI)	Belantamab-Compound (XIX) payload	Undisclosed	Belantamab-Compound (XIX) linker	[3]
ADC Info	Belantamab-Compound (XL)	Belantamab-Compound (XL) payload	Undisclosed	Belantamab-Compound (XL) linker	[3]
ADC Info	Belantamab-Compound (XLII)	Belantamab-Compound (XLII) payload	Undisclosed	Belantamab-Compound (XLII) linker	[3]
ADC Info	Belantamab-Compound (XV)	Belantamab-Compound (XV) payload	Undisclosed	Belantamab-Compound (XV) linker	[3]
ADC Info	Belantamab-Compound (XLIII)	Belantamab-Compound (XLIII) payload	Undisclosed	Belantamab-Compound (XLIII) linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	GENA-111-AF	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Ispectamab debotansine	Undisclosed	Undisclosed	Undisclosed	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HDP-101	HDP 30.2115	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mal-Val-Ala-PAB	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SG1-Val-Cit-MMAF8	Monomethyl auristatin F	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SG2-Val-Cit-MMAF8	Monomethyl auristatin F	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SG3-Val-Cit-MMAF8	Monomethyl auristatin F	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LMB-75	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[11]
ADC Info	LMB-70	Pseudomonas exotoxin PE24	Eukaryotic elongation factor 2 (EEF2)	Undisclosed	[12]
ADC Info	JS115	Undisclosed	Undisclosed	Undisclosed	[13]
ADC Info	HD-101	Undisclosed	Undisclosed	Undisclosed	[9]
ADC Info	BCMA-077	Duostatin 5.2	Microtubule (MT)	Proprietary Concortis linker	[14]
ADC Info	BCMA-024	Duostatin 5.2	Microtubule (MT)	Proprietary Concortis linker	[14]
ADC Info	Ispectamab tazide	Undisclosed	Undisclosed	Undisclosed	[15]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.52E-18; Fold-change: 3.122347755; Z-score: 1.994226681
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.331881317; Fold-change: -0.010849904; Z-score: -0.284950846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.66778461; Fold-change: -0.113561904; Z-score: -0.292199765
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.986211929; Fold-change: -0.073840353; Z-score: -0.220288714
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.00E-08; Fold-change: 0.082541462; Z-score: 0.371827938
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001505918; Fold-change: -0.484175194; Z-score: -0.59155559
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00066657; Fold-change: -0.953146094; Z-score: -1.213878203
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.05E-08; Fold-change: 0.122374208; Z-score: 0.520641354
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.297346353; Fold-change: -1.447986786; Z-score: -0.855843791
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.602881605; Fold-change: -0.25461628; Z-score: -0.554510831
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.469257303; Fold-change: -1.441058242; Z-score: -0.569339339
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.58E-06; Fold-change: -3.03439155; Z-score: -1.881174726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.16E-90; Fold-change: -3.644835204; Z-score: -3.574469107
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.95E-24; Fold-change: -3.384712234; Z-score: -1.632028843
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.320491645; Fold-change: 0.715020891; Z-score: 0.477242758
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.351116344; Fold-change: 0.427818262; Z-score: 0.205393941
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077813056; Fold-change: -0.34277196; Z-score: -0.605229713
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.23E-19; Fold-change: -0.916138396; Z-score: -0.98851839
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.360741231; Fold-change: -0.654375938; Z-score: -1.448375561
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.53E-14; Fold-change: 1.094372667; Z-score: 0.78263291
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.08E-20; Fold-change: 1.400408395; Z-score: 1.256330216
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000691944; Fold-change: 0.697305369; Z-score: 0.711230787
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.42E-07; Fold-change: -0.005788607; Z-score: -0.029638646
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.053924158; Fold-change: -0.006136129; Z-score: -0.043753387
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.02E-09; Fold-change: -0.861758859; Z-score: -0.609745709
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.47E-05; Fold-change: -1.773956431; Z-score: -1.007424618
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002597083; Fold-change: 0.094195267; Z-score: 0.262564046
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002906071; Fold-change: 0.026919535; Z-score: 0.060702909
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004426047; Fold-change: 0.702512474; Z-score: 0.771339411
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.20E-26; Fold-change: 0.772715444; Z-score: 1.191506134
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001982672; Fold-change: 0.431916354; Z-score: 1.373884752
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.481147797; Fold-change: 0.900597982; Z-score: 0.470364291
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.143352931; Fold-change: -2.08586932; Z-score: -1.22977056
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082204747; Fold-change: -0.086243846; Z-score: -0.923802851
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.223159191; Fold-change: 0.087496957; Z-score: 0.039809326
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.716038437; Fold-change: -0.023761149; Z-score: -0.013399718
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.32139533; Fold-change: -0.06312443; Z-score: -0.648095634
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.10E-09; Fold-change: 2.306981513; Z-score: 1.282688704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.769823349; Fold-change: -0.058985747; Z-score: -0.338538097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.867231208; Fold-change: -0.104764579; Z-score: -0.545691903
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.709519071; Fold-change: -0.500279897; Z-score: -0.273951143
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.59E-05; Fold-change: 1.078783947; Z-score: 0.567806736
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.829579722; Fold-change: -0.021963433; Z-score: -0.185800787
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.457568661; Fold-change: 0.281140409; Z-score: 0.391603567
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.367687603; Fold-change: 0.011552709; Z-score: 0.083540365
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.934463264; Fold-change: -0.021904152; Z-score: -0.030076374
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113545751; Fold-change: -0.632726737; Z-score: -0.92087781
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.643124069; Fold-change: 0.079884903; Z-score: 0.145718378
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.083164636; Fold-change: 0.087614168; Z-score: 0.124859396
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004937732; Fold-change: -0.749534003; Z-score: -0.647970162
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.90186037; Fold-change: 0.032865358; Z-score: 0.136043953
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038092191; Fold-change: 0.849460691; Z-score: 2.528155663
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.722258147; Fold-change: 0.008218961; Z-score: 0.007575839
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.17E-05; Fold-change: -1.601560055; Z-score: -1.034796918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.68E-11; Fold-change: -0.937005656; Z-score: -0.650945592
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.438194681; Fold-change: -0.317308295; Z-score: -0.450287966
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.871009692; Fold-change: -0.013623589; Z-score: -0.087124486
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008000262; Fold-change: -1.775927781; Z-score: -0.896140866
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.180597375; Fold-change: -0.556538134; Z-score: -1.387628222
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.474610846; Fold-change: 0.191206333; Z-score: 0.389274079
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.464785744; Fold-change: 0.4398841; Z-score: 0.512139465
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035542589; Fold-change: 0.214848291; Z-score: 0.911369993
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.189349808; Fold-change: 0.10708905; Z-score: 1.217479485
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.080586549; Fold-change: 2.12079696; Z-score: 2.311352155
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.839252145; Fold-change: -0.017869431; Z-score: -0.063221691
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.229492491; Fold-change: 0.261278843; Z-score: 0.934160744
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.891678293; Fold-change: -0.039350044; Z-score: -0.031961155
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.267414984; Fold-change: 0.018771853; Z-score: 0.105007829
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.400063306; Fold-change: -0.060649909; Z-score: -0.121765438
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.988336386; Fold-change: -0.00942386; Z-score: -0.074518331
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010165763; Fold-change: 0.868092582; Z-score: 1.489605978
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.45E-14; Fold-change: 2.83963031; Z-score: 1.840723446
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.51778432; Fold-change: 2.755146669; Z-score: 1.069692685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-07; Fold-change: 4.078429654; Z-score: 5.777773844
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.29926457; Fold-change: 1.812488533; Z-score: 0.694481436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.520181336; Fold-change: -0.007762066; Z-score: -0.010543021
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.382701944; Fold-change: -0.106123212; Z-score: -0.889604265
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001252733; Fold-change: 0.166662346; Z-score: 0.365654166
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00529483; Fold-change: -0.181326453; Z-score: -0.267723181
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.86843161; Fold-change: -0.512572481; Z-score: -0.736890451
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.115470043; Fold-change: 0.201020383; Z-score: 0.294601826
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.298603057; Fold-change: -0.741406085; Z-score: -1.208530981
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.484871728; Fold-change: 0.003238464; Z-score: 0.017916721
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.602097403; Fold-change: -0.211635796; Z-score: -0.25312834
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008311748; Fold-change: -0.449930451; Z-score: -0.408613931
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.63E-06; Fold-change: 0.144790081; Z-score: 0.471805681
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.949028373; Fold-change: 0.018983694; Z-score: 0.167964264
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.441880235; Fold-change: 0.058673002; Z-score: 0.276974793
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012553607; Fold-change: 2.830998312; Z-score: 1.321690948
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.228749378; Fold-change: -0.173097614; Z-score: -0.244213349
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.35E-12; Fold-change: -0.735187612; Z-score: -0.556394377
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.32E-05; Fold-change: 1.013408162; Z-score: 3.369312108
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.45088209; Fold-change: 0.050809789; Z-score: 0.070104221
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.173774683; Fold-change: 0.64794547; Z-score: 0.415954085
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.102548296; Fold-change: -0.419699023; Z-score: -0.261027717
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.61953701; Fold-change: -1.321979217; Z-score: -0.770168497
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.05E-08; Fold-change: -4.164218927; Z-score: -7.930142665
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.84E-07; Fold-change: -3.994749261; Z-score: -6.449341803
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.86E-22; Fold-change: 0.39656187; Z-score: 0.637529941
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.73E-16; Fold-change: 0.235560466; Z-score: 0.393709702
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.47E-07; Fold-change: 0.155922165; Z-score: 0.810036741
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.45E-08; Fold-change: 0.202915133; Z-score: 0.459464123
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.858759505; Fold-change: 0.017656704; Z-score: 0.105668858
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.634474519; Fold-change: -0.02097205; Z-score: -0.195095581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.127087943; Fold-change: 0.117312348; Z-score: 1.197261551
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.8771069; Fold-change: -0.022134295; Z-score: -0.019540198
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.052883545; Fold-change: -0.25925456; Z-score: -0.662454418
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.946830968; Fold-change: 0.244673525; Z-score: 0.309246589
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048465514; Fold-change: -0.981047836; Z-score: -0.964562137
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.576230753; Fold-change: -0.384590939; Z-score: -0.589062898
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.446986039; Fold-change: 0.325119576; Z-score: 0.609109489
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.982098699; Fold-change: 0.056990255; Z-score: 0.094030724
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.205221306; Fold-change: -0.028696527; Z-score: -0.14702984
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.131930703; Fold-change: 0.142362865; Z-score: 0.718803486
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.403139285; Fold-change: 0.048691558; Z-score: 0.414820926
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.124799433; Fold-change: 0.027732304; Z-score: 0.136374259
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.943630696; Fold-change: -0.016826339; Z-score: -0.095039255
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.180693553; Fold-change: -0.510682679; Z-score: -0.459759146
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.62126815; Fold-change: -0.322105267; Z-score: -0.288818296
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048795047; Fold-change: -0.146210439; Z-score: -0.205636477
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.983324164; Fold-change: 0.041501377; Z-score: 0.463914273
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070766614; Fold-change: -0.842991405; Z-score: -0.954804545
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.492811429; Fold-change: -0.015439834; Z-score: -0.119547347
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.103724032; Fold-change: 1.147566597; Z-score: 0.81121349
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.748333447; Fold-change: -0.07410185; Z-score: -0.602136061
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.489721215; Fold-change: 0.112985335; Z-score: 0.483443731
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.315601706; Fold-change: -0.108966403; Z-score: -0.523970888
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001208142; Fold-change: 0.32133498; Z-score: 2.035871441
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Bcma monoclonal antibody-drug conjugate.
Ref 2	Phase 1 study of the anti-BCMA antibody-drug conjugate AMG 224 in patients with relapsed/refractory multiple myeloma. Leukemia. 2021 Jan;35(1):255-258.
Ref 3	Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 4	BCMA-Specific ADC MEDI2228 and Daratumumab Induce Synergistic Myeloma Cytotoxicity via IFN-Driven Immune Responses and Enhanced CD38 Expression. Clin Cancer Res. 2021 Oct 1;27(19):5376-5388.
Ref 5	Belantamab Mafodotin-blmf: A Novel Antibody-Drug Conjugate for Treatment of Patients With Relapsed/Refractory Multiple Myeloma. J Adv Pract Oncol. 2022 Jan;13(1):77-85. doi: 10.6004/jadpro.2022.13.1.7. Epub 2022 Feb 1.
Ref 6	Neodegrader conjugates; 2021-10-07.
Ref 7	The antibody-drug conjugate GENA-111 conjugated to auristatin F shows therapeutic potency in BCAM positive epithelial cancer. 2022.
Ref 8	A Study of CC-99712, a BCMA Antibody-Drug Conjugate, in Participants With Relapsed and Refractory Multiple Myeloma.
Ref 9	HDP-101, an Anti-BCMA Antibody-Drug Conjugate, Safely Delivers Amanitin to Induce Cell Death in Proliferating and Resting Multiple Myeloma Cells. Mol Cancer Ther. 2021 Feb;20(2):367-378.
Ref 10	Antibody targeting of B-cell maturation antigen on malignant plasma cells. Mol Cancer Ther. 2007 Nov;6(11):3009-18. doi: 10.1158/1535-7163.MCT-07-0464.
Ref 11	Anti-BCMA immunotoxins produce durable complete remissions in two mouse myeloma models. Proc Natl Acad Sci U S A. 2019 Mar 5;116(10):4592-4598. doi: 10.1073/pnas.1821733116. Epub 2019 Feb 19.
Ref 12	Targeted Therapy With Immunoconjugates for Multiple Myeloma. Front Immunol. 2020 Jun 19;11:1155. doi: 10.3389/fimmu.2020.01155. eCollection 2020.
Ref 13	Junshi Biosciences biopharmaceutical company product pipeline
Ref 14	Preclinical Development of a Bcma Targeting Antibody-Drug Conjugate with Novel Payload for Multiple Myeloma Therapy. Blood. 2019 ;134():-. doi: 10.1182/blood-2019-132080.
Ref 15	Introduction to basic information on ADC drug Ispectamab tazide.