Antibody Information
General Information of This Antibody
| Antibody ID | ANI0ZVBXO |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-BCMA antibody I09 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISGSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGNYFVEYFQQWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
EIVLTQSPGTLSLSPGERATLSCRASQYISSNYLAWYQQKPGQAPRLLIYGASNRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSSDPITFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-BCMA I09-SG3249 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94.55% (Day 21) | High BCMA expression (BCMA+++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of the ADCs at 0.3 mg/kg or dosed intravenously with J6M0-mc-MMAFweekly at a dose of 0.3 mg/kg for 2 weeks.
|
||||
| In Vivo Model | NCI-H929 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.16% (Day 21) | Moderate BCMA expression (BCMA++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 1 mg/kg for 3 weeks. Control mice were left untreated.
|
||||
| In Vivo Model | JJN-3 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | JJN-3 cells | CVCL_2078 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.37% (Day 32) | Moderate BCMA expression (BCMA++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 1 mg/kg for 4 weeks. Control mice were left untreated.
|
||||
| In Vivo Model | MM.1S CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.81 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 0 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.55 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 270 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
7.79 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 75 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
16.16 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 720 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
