Antibody Information
General Information of This Antibody
| Antibody ID | ANI0FDLEU |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-BCMA antibody 15B2WT |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
EIQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSISGSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARGGNYYVEYFQYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
EIVLTQSPGTLSLSPGERATLSCRASQYISSNYLAWYQQKPGQAPRLLIYGASNRATGIP
DRFSGSGSGTGFTLTISRLEPEDFAVFYCQQYGSSPITFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-BCMA 15B2WT-mcMMAF [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.16% | Moderate BCMA expression (BCMA++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 1 mg/kg for 3 weeks. Control mice were left untreated.
|
||||
| In Vivo Model | JJN-3 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | JJN-3 cells | CVCL_2078 | ||
Anti-BCMA 15B2WT-SG3249 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.59% | High BCMA expression (BCMA+++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of the ADCs at 0.3 mg/kg or dosed intravenously with J6M0-mc-MMAFweekly at a dose of 0.3 mg/kg for 2 weeks.
|
||||
| In Vivo Model | NCI-H929 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
