Antibody Information
General Information of This Antibody
| Antibody ID | ANI0ARKXL |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-BCMA antibody 15B2GL |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSISGSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGNYYVEYFQYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
EIVLTQSPGTLSLSPGERATLSCRASQYISSNYLAWYQQKPGQAPRLLIYGASNRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-BCMA 15B2GL-SG3249 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.37% (Day 32) | Moderate BCMA expression (BCMA++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 1 mg/kg for 4 weeks. Control mice were left untreated.
|
||||
| In Vivo Model | MM.1S CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.73% (Day 35) | High BCMA expression (BCMA+++) | ||
| Method Description |
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 3 mg/kg for 4 weeks. Control mice were left untreated.
|
||||
| In Vivo Model | MM.1R CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MM1.R cells | CVCL_8794 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.99 nM
|
High BCMA expression (BCMA+++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
8.64 nM
|
High BCMA expression (BCMA+++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.R cells | CVCL_8794 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
14.47 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 0 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
16.09 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 75 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
16.80 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
22.86 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 270 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
29.12 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 720 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
31.40 nM
|
Low BCMA expression (BCMA+) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | L-363 cells | CVCL_1357 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
36.28 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | JJN-3 cells | CVCL_2078 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
39.00 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | U266B1 cells | CVCL_0566 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
153.00 nM
|
High BCMA expression (BCMA+++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | EJM cells | CVCL_2030 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
201.00 nM
|
Moderate BCMA expression (BCMA++) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | Plasma cell myeloma | OPM-2 cells | CVCL_1625 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 500.00 nM | Negative BCMA expression (BCMA-) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | EBV-related Burkitt lymphoma | Raji cells | CVCL_0511 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 500.00 nM | Negative BCMA expression (BCMA-) | ||
| Method Description |
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
|
||||
| In Vitro Model | T acute lymphoblastic leukemia | Jurkat cells | CVCL_0065 | ||
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.