General Information of This Antibody
Antibody ID
ANI0ARKXL
Antibody Name
Anti-BCMA antibody 15B2GL
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Tumor necrosis factor receptor superfamily member 17 (TNFRSF17)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
EVQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSISGSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGNYYVEYFQYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Constant Domain
EIVLTQSPGTLSLSPGERATLSCRASQYISSNYLAWYQQKPGQAPRLLIYGASNRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-BCMA 15B2GL-SG3249 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.37% Moderate BCMA expression (BCMA++)
Method Description
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 1 mg/kg for 4 weeks. Control mice were left untreated.
In Vivo Model MM.1S CDX model
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.73% High BCMA expression (BCMA+++)
Method Description
Mice were treated with either a single intravenous dose of ADCs at 1 mg/kg, or dosed intravenously with J6M0-mc-MMAF ADC weekly at a dose of 3 mg/kg for 4 weeks. Control mice were left untreated.
In Vivo Model MM.1R CDX model
In Vitro Model Plasma cell myeloma MM1.R cells CVCL_8794
Revealed Based on the Cell Line Data
Click To Hide/Show 14 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.99 nM
High BCMA expression (BCMA+++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma NCI-H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
8.64 nM
High BCMA expression (BCMA+++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma MM1.R cells CVCL_8794
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
14.47 nM
Moderate BCMA expression (BCMA++)
Method Description
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 0 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
16.09 nM
Moderate BCMA expression (BCMA++)
Method Description
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 75 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
16.8 nM
Moderate BCMA expression (BCMA++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
22.86 nM
Moderate BCMA expression (BCMA++)
Method Description
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 270 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
29.12 nM
Moderate BCMA expression (BCMA++)
Method Description
The ability of the ADCs to kill multiple myeloma cells in vitro inthe presence of soluble BCMA (sBCMA, 720 ng/ml) as compared to the 09-SG3249 ADC was evaluated in MM.1S cells, except that tested cell lines also were treated with BCMA-containing conditioned media collected from Ad293 cells expressing human BCMA.
In Vitro Model Plasma cell myeloma MM1.S cells CVCL_8792
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
31.4 nM
Low BCMA expression (BCMA+)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma L-363 cells CVCL_1357
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
36.28 nM
Moderate BCMA expression (BCMA++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma JJN-3 cells CVCL_2078
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
39 nM
Moderate BCMA expression (BCMA++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma U266B1 cells CVCL_0566
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
153 nM
High BCMA expression (BCMA+++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma EJM cells CVCL_2030
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
201 nM
Moderate BCMA expression (BCMA++)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model Plasma cell myeloma OPM-2 cells CVCL_1625
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 500 nM Negative BCMA expression (BCMA-)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model T acute lymphoblastic leukemia Jurkat cells CVCL_0065
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 500 nM Negative BCMA expression (BCMA-)
Method Description
Treatments were then serially diluted 1:3 in RPMI+10% FBS. 20uL of this series was added to the cells in duplicate, resulting in a 12-point dose curve of antibody-drug conjugate and media-only controls also were included. Plates were incubated at 37°C, 5% CO for 9 hours.
In Vitro Model EBV-related Burkitt lymphoma Raji cells CVCL_0511
References
Ref 1 Bcma monoclonal antibody-drug conjugate.