Antigen ID	TAR0QPCSQ
Antigen Name	Tumor necrosis factor receptor superfamily member 8 (TNFRSF8)
Gene Name	TNFRSF8
Gene ID	943
Synonym	CD30L receptor;Ki-1 antigen;Lymphocyte activation antigen CD30;CD_antigen=CD30
Sequence	MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK     Click to Show/Hide
Family	Tissue factor family
Function	Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa- B.     Click to Show/Hide
Uniprot Entry	TNR8_HUMAN
HGNC ID	HGNC:11923
KEGG ID	hsa:943

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD30-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	DAR8-alphaCD30-mDPR-Gluc-DMTub	DMTub	Microtubule (MT)	Quaternary ammonium linker Gluc	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	DAR8-alphaCD30-mDPR-Gluc-MMAE	Monomethyl auristatin E	Microtubule (MT)	Quaternary ammonium linker Gluc	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	DAR8-alphaCD30-mDPR-GlucQ-AE	Auristatin E	Microtubule (MT)	Quaternary ammonium linker GlucQ	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	DAR8-alphaCD30-mDPR-GlucQ-Tub	Tubulysin analogue 3	Microtubule (MT)	Quaternary ammonium linker GlucQ	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-CD30-7	Tubulysin 7	Microtubule (MT)	Glucuronide quaternary ammonium linker 7	[3]
ADC Info	Alpha-CD30-8	Tubulysin 8	Microtubule (MT)	Glucuronide quaternary ammonium linker 8	[3]
ADC Info	Alpha-CD30-9	Tubulysin 9	Microtubule (MT)	Glucuronide quaternary ammonium linker 9	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD30 monoclonal antibody-saporin conjugate	Saporin	Microtubule (MT)	Undisclosed	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD30-BTG-ADC	Monomethyl auristatin E	Microtubule (MT)	PEG3-benzotriazole-PEG-Val-Cit-PABC	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	H00-CPT-LC	Methylenedioxy CPT2 (CPT2)	DNA topoisomerase 1 (TOP1)	Mc-PEG8-Val-Lys-Gly	[6]
ADC Info	H00-CPT-LA	Methylenedioxy CPT1 (CPT1)	DNA topoisomerase 1 (TOP1)	Mc-PEG4-Val-Lys-Gly	[6]
ADC Info	H00-CPT-LB	Methylenedioxy CPT2 (CPT2)	DNA topoisomerase 1 (TOP1)	Mc-PEG4-Val-Lys-Gly	[6]
ADC Info	H00-GT	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[7]
ADC Info	H00-DT	DX-8951 derivative (DXd)	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Brentuximab vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]
ADC Info	F0002-ADC	Mertansine DM1	Microtubule (MT)	Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)	[9]
ADC Info	Brentuximab-8	Monomethyl auristatin E	Microtubule (MT)	Alkyl phosphoramide-PEG24-Val-Cit-PAB	[10]
ADC Info	Brentuximab-7	Monomethyl auristatin E	Microtubule (MT)	Alkyl phosphoramide-PEG12-Val-Cit-PAB	[10]
ADC Info	CAC10-CPT-LB	Methylenedioxy CPT2 (CPT2)	DNA topoisomerase 1 (TOP1)	Mc-PEG4-Val-Lys-Gly	[6]
ADC Info	CAC10-CPT-LC	Methylenedioxy CPT2 (CPT2)	DNA topoisomerase 1 (TOP1)	Mc-PEG8-Val-Lys-Gly	[6]
ADC Info	CAC10-GT	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[6]
ADC Info	CAC10-CPT-LA	Methylenedioxy CPT1 (CPT1)	DNA topoisomerase 1 (TOP1)	Mc-PEG4-Val-Lys-Gly	[6]
ADC Info	MF-BTX-MMAE	Monomethyl auristatin E	Microtubule (MT)	Dibromomethyl pyridine-Val-Cit-PABC	[11]
ADC Info	Brentuximab-PNUEDAGly5	PNU-159682	DNA topoisomerase 2-alpha (TOP2A)	LPETG-Gly5-EDA	[12]
ADC Info	Brentuximab-ADC-24-1	Brentuximab-ADC-24-1 payload	Undisclosed	Brentuximab-ADC-24-1 linker	[13]
ADC Info	Brentuximab-ADC-24-2	Brentuximab-ADC-24-2 payload	Undisclosed	Brentuximab-ADC-24-2 linker	[13]
ADC Info	Brentuximab-ADC-24-3	Brentuximab-ADC-24-3 payload	Undisclosed	Brentuximab-ADC-24-3 linker	[13]
ADC Info	Brentuximab-ADC-24-4	Brentuximab-ADC-24-4 payload	Undisclosed	Brentuximab-ADC-24-4 linker	[13]
ADC Info	Brentuximab-ADC-24-5	Brentuximab-ADC-24-5 payload	Undisclosed	Brentuximab-ADC-24-5 linker	[13]
ADC Info	Brentuximab-ADC-24-6	Brentuximab-ADC-24-6 payload	Undisclosed	Brentuximab-ADC-24-6 linker	[13]
ADC Info	Brentuximab-ADC-24-7	Brentuximab-ADC-24-7 payload	Undisclosed	Brentuximab-ADC-24-7 linker	[13]
ADC Info	Brentuximab-ADC-24-8	Brentuximab-ADC-24-8 payload	Undisclosed	Brentuximab-ADC-24-8 linker	[13]
ADC Info	Brentuximab-ADC-24-9	Brentuximab-ADC-24-9 payload	Undisclosed	Brentuximab-ADC-24-9 linker	[13]
ADC Info	Brentuximab-ADC-24-10	Brentuximab-ADC-24-10 payload	Undisclosed	Brentuximab-ADC-24-10 linker	[13]
ADC Info	Brentuximab-ADC-24-11	Brentuximab-ADC-24-11 payload	Undisclosed	Brentuximab-ADC-24-11 linker	[13]
ADC Info	Brentuximab-ADC-24-12	Brentuximab-ADC-24-12 payload	Undisclosed	Brentuximab-ADC-24-12 linker	[13]
ADC Info	Brentuximab-ADC-24-13	Brentuximab-ADC-24-13 payload	Undisclosed	Brentuximab-ADC-24-13 linker	[13]
ADC Info	EphA2-targeted mAb ADC B 12 (DAR8)	EphA2-targeted mAb ADC B 12 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 12 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 12 (DAR4)	EphA2-targeted mAb ADC B 12 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 12 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 17 (DAR8)	EphA2-targeted mAb ADC B 17 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 17 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 17 (DAR4)	EphA2-targeted mAb ADC B 17 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 17 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 21 (DAR8)	EphA2-targeted mAb ADC B 21 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 21 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 21 (DAR4)	EphA2-targeted mAb ADC B 21 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 21 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 22 (DAR6)	EphA2-targeted mAb ADC B 22 (DAR6) payload	Undisclosed	EphA2-targeted mAb ADC B 22 (DAR6) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 22 (DAR2)	EphA2-targeted mAb ADC B 22 (DAR2) payload	Undisclosed	EphA2-targeted mAb ADC B 22 (DAR2) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 19 (DAR8)	EphA2-targeted mAb ADC B 19 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 19 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 19 (DAR4)	EphA2-targeted mAb ADC B 19 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 19 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 20 (DAR8)	EphA2-targeted mAb ADC B 20 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 20 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 20 (DAR4)	EphA2-targeted mAb ADC B 20 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 20 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 24 (DAR8)	EphA2-targeted mAb ADC B 24 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 24 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 24 (DAR4)	EphA2-targeted mAb ADC B 24 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 24 (DAR4) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 23 (DAR8)	EphA2-targeted mAb ADC B 23 (DAR8) payload	Undisclosed	EphA2-targeted mAb ADC B 23 (DAR8) linker	[14]
ADC Info	EphA2-targeted mAb ADC B 23 (DAR4)	EphA2-targeted mAb ADC B 23 (DAR4) payload	Undisclosed	EphA2-targeted mAb ADC B 23 (DAR4) linker	[14]
ADC Info	CAC10-Gly5-PNU	PNU-159682	DNA topoisomerase 2-alpha (TOP2A)	Gly5	[15]
ADC Info	CAC10-Gly5-MAY	Mertansine DM1	Microtubule (MT)	Gly5	[15]
ADC Info	CAC10-DT	DX-8951 derivative (DXd)	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly	[6]
ADC Info	WO2007011968A2 cAC10-9a	Monomethyl auristatin E	Microtubule (MT)	WO2007011968A2_cAC10-9a linker	[16]
ADC Info	WO2007011968A2 cAC10-9b	Monomethyl auristatin F	Microtubule (MT)	WO2007011968A2_cAC10-9b linker	[16]
ADC Info	WO2007011968A2 cAC10-17	Doxorubicin	DNA topoisomerase 2-alpha (TOP2A)	WO2007011968A2_cAC10-17 linker	[16]
ADC Info	WO2015095755A1 cAC10-1.3	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_cAC10-1.3 linker	[17]
ADC Info	WO2015095755A1 cAC10-1006	WO2015095755A1_cAC10-1006 payload	Undisclosed	WO2015095755A1_cAC10-1006 linker	[17]
ADC Info	WO2015095755A1 cAC10-2.0	Monomethyl auristatin E	Microtubule (MT)	WO2015095755A1_cAC10-2.0 linker	[17]
ADC Info	WO2015095755A1 cAC10-5.6	WO2015095755A1_cAC10-5.6 payload	Undisclosed	WO2015095755A1_cAC10-5.6 linker	[17]
ADC Info	WO2015095755A1 cAC10-6.4	WO2015095755A1_cAC10-6.4 payload	Undisclosed	WO2015095755A1_cAC10-6.4 linker	[17]
ADC Info	WO2015095755A1 cAC10-7.7	WO2015095755A1_cAC10-7.7 payload	Undisclosed	WO2015095755A1_cAC10-7.7 linker	[17]
ADC Info	Crown Ether ADC 4a	Monomethyl auristatin E	Microtubule (MT)	6-Amino-alpha-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 4b	Monomethyl auristatin E	Microtubule (MT)	6-Amino-beta-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 4c	Monomethyl auristatin E	Microtubule (MT)	6-Amino-gama-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 4d	Monomethyl auristatin E	Microtubule (MT)	3-Amino-alpha-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 4e	Monomethyl auristatin E	Microtubule (MT)	3-Amino-beta-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 4f	Monomethyl auristatin E	Microtubule (MT)	3-Amino-gama-cyclodextrin-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 5a	Monomethyl auristatin E	Microtubule (MT)	1-Aza-24-crown-8-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 5b	Monomethyl auristatin E	Microtubule (MT)	1-Aza-42-crown-14-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 6a	Monomethyl auristatin E	Microtubule (MT)	PEG(8u)-Val-Cit-PABC	[18]
ADC Info	Crown Ether ADC 6b	Monomethyl auristatin E	Microtubule (MT)	PEG(24u)-Val-Cit-PABC	[18]
ADC Info	Brentuximab-Compound 9	Mertansine DM1	Microtubule (MT)	Brentuximab-Compound 9 linker	[19]
ADC Info	Brentuximab-Compound 17	Mertansine DM4	Microtubule (MT)	Brentuximab-Compound 17 linker	[19]
ADC Info	Brentuximab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 25 linker	[19]
ADC Info	Brentuximab-Compound 31	Auristatin 0101	Microtubule (MT)	Brentuximab-Compound 31 linker	[19]
ADC Info	Brentuximab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 36 linker	[19]
ADC Info	Brentuximab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Brentuximab-Compound 43 linker	[19]
ADC Info	Brentuximab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Brentuximab-Compound 49 linker	[19]
ADC Info	Brentuximab-Compound 55	Mertansine DM1	Microtubule (MT)	Brentuximab-Compound 55 linker	[19]
ADC Info	Brentuximab-Compound 59	Mertansine DM4	Microtubule (MT)	Brentuximab-Compound 59 linker	[19]
ADC Info	Brentuximab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 64 linker	[19]
ADC Info	Brentuximab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 69 linker	[19]
ADC Info	Brentuximab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Brentuximab-Compound 74 linker	[19]
ADC Info	Brentuximab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 75 linker	[19]
ADC Info	Brentuximab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Brentuximab-Compound 76 linker	[19]
ADC Info	Brentuximab-Compound 77	Mertansine DM1	Microtubule (MT)	Brentuximab-Compound 77 linker	[19]
ADC Info	Brentuximab-Compound 78	Auristatin 0101	Microtubule (MT)	Brentuximab-Compound 78 linker	[19]
ADC Info	Brentuximab-Compound 79	Auristatin 0101	Microtubule (MT)	Brentuximab-Compound 79 linker	[19]
ADC Info	Brentuximab-Compound 80	Mertansine DM4	Microtubule (MT)	Brentuximab-Compound 80 linker	[19]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Monoclonal antibody IRac-ricin A conjugate	Deglycosylated ricin A-chain (dgA)	Undisclosed	Undisclosed	[20]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD30-LDM	Lidamycin	Human Deoxyribonucleic acid (hDNA)	Uncleavable linker	[21]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Recombinant chimeric anti-CD30 mAb-MCC-DM1	Undisclosed	Undisclosed	Undisclosed	[22]
ADC Info	TUB-010	Undisclosed	Undisclosed	Undisclosed	[23]
ADC Info	Anti-CD30 antibody drug conjugate (NBE-Therapeutics)	Undisclosed	Undisclosed	Undisclosed	[24]
ADC Info	AVP10	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[25]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.400086288; Fold-change: -0.011931585; Z-score: -0.053169615
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.704660292; Fold-change: 0.17937956; Z-score: 0.407717895
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.16E-07; Fold-change: -0.826434468; Z-score: -3.39709883
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000922392; Fold-change: 0.692920239; Z-score: 1.887775648
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.12E-13; Fold-change: 0.087625355; Z-score: 0.346169452
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-14; Fold-change: -0.313272246; Z-score: -1.872527764
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000219574; Fold-change: -0.326933553; Z-score: -1.888508989
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.019294937; Fold-change: 0.086182001; Z-score: 0.629155767
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.250790442; Fold-change: -0.263361113; Z-score: -1.019802369
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.978093057; Fold-change: -0.05064933; Z-score: -0.22873554
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.967169379; Fold-change: -0.065119468; Z-score: -0.398948341
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.12701012; Fold-change: -0.103718457; Z-score: -0.359093798
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004669723; Fold-change: 0.076752432; Z-score: 0.320689643
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.52E-05; Fold-change: -0.140579025; Z-score: -0.541527589
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012966549; Fold-change: -0.219416694; Z-score: -0.843049027
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.528660109; Fold-change: -0.019040539; Z-score: -0.060064828
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.162652987; Fold-change: -0.05890579; Z-score: -0.252786231
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.441488482; Fold-change: -0.017139101; Z-score: -0.068876788
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.704883846; Fold-change: 0.048952918; Z-score: 0.194760877
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.13E-12; Fold-change: -0.152861102; Z-score: -0.556958122
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.18E-08; Fold-change: -0.177942344; Z-score: -0.612413638
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.303627253; Fold-change: -0.044207857; Z-score: -0.081203153
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.10E-27; Fold-change: -0.275794353; Z-score: -1.165908432
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.49100039; Fold-change: -0.051914848; Z-score: -0.316761624
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.19E-33; Fold-change: -0.339449158; Z-score: -1.093399025
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.48E-05; Fold-change: -0.156597256; Z-score: -0.516495598
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132466265; Fold-change: -0.203634435; Z-score: -0.475774805
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.90E-05; Fold-change: -0.867540294; Z-score: -1.512561858
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.39978478; Fold-change: 0.106372011; Z-score: 0.427798316
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002233541; Fold-change: -0.098172738; Z-score: -0.270463761
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.788833232; Fold-change: -0.024185905; Z-score: -0.131855384
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000400405; Fold-change: -0.382848452; Z-score: -0.851255482
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015560926; Fold-change: 0.122160345; Z-score: 0.677235096
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.615336538; Fold-change: 0.018973746; Z-score: 0.195913525
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005520942; Fold-change: 0.098838792; Z-score: 0.332043186
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.41E-06; Fold-change: 0.170213352; Z-score: 0.926635333
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.18139428; Fold-change: -0.042296716; Z-score: -0.265556275
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.121407312; Fold-change: 0.022441605; Z-score: 0.084482892
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.443584254; Fold-change: -0.211644959; Z-score: -0.77726348
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.220323174; Fold-change: 0.106012552; Z-score: 0.365357614
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.912674692; Fold-change: -0.175211114; Z-score: -0.334878475
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.085195348; Fold-change: 0.074296838; Z-score: 0.137401429
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.780629696; Fold-change: -0.089012425; Z-score: -0.181888449
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.13E-06; Fold-change: 0.844411239; Z-score: 1.757345281
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.471692133; Fold-change: 0.029134674; Z-score: 0.378217445
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.983884578; Fold-change: -0.081330408; Z-score: -0.45980084
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.218594209; Fold-change: 0.227595645; Z-score: 0.94686701
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.192974403; Fold-change: 0.159719127; Z-score: 0.794436409
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022518307; Fold-change: 0.179308784; Z-score: 0.595488869
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.226899906; Fold-change: -0.185925481; Z-score: -0.33859267
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257575551; Fold-change: -0.083326754; Z-score: -0.496173287
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027801383; Fold-change: -0.980221121; Z-score: -2.386507795
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.807492481; Fold-change: -0.005249554; Z-score: -0.023286916
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036072041; Fold-change: -0.023856457; Z-score: -0.061589399
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018456227; Fold-change: -0.028909514; Z-score: -0.083377161
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.266442735; Fold-change: 0.195975034; Z-score: 0.497652481
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.786409782; Fold-change: -0.003722087; Z-score: -0.099274703
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000619174; Fold-change: 0.246030832; Z-score: 0.58360698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.090151152; Fold-change: 0.12681423; Z-score: 0.588710083
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.992282057; Fold-change: 0.113953044; Z-score: 0.260929821
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.846330434; Fold-change: 0.010176159; Z-score: 0.041365215
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.883722522; Fold-change: 0.022561618; Z-score: 0.074853413
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.209509197; Fold-change: 0.008066105; Z-score: 0.110690503
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.395272603; Fold-change: 0.023985659; Z-score: 0.139036806
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004335033; Fold-change: 0.328222742; Z-score: 2.73985906
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.362133106; Fold-change: -0.088649284; Z-score: -0.523709994
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.326756823; Fold-change: -0.040868407; Z-score: -0.205495184
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005085998; Fold-change: 0.128423353; Z-score: 0.593661107
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007299711; Fold-change: -0.083493737; Z-score: -0.194924967
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.916496482; Fold-change: -0.000598005; Z-score: -0.004142339
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.340677325; Fold-change: -0.128438498; Z-score: -0.659753077
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.941174087; Fold-change: -0.004250223; Z-score: -0.019435021
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.249227853; Fold-change: 0.104000873; Z-score: 0.612748998
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005511873; Fold-change: 0.370009384; Z-score: 2.373722547
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.042616212; Fold-change: 0.107355526; Z-score: 0.490455303
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.68679562; Fold-change: -0.008389096; Z-score: -0.030916271
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.64E-05; Fold-change: 0.092123742; Z-score: 0.873267631
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.039305173; Fold-change: -0.078988502; Z-score: -0.265004882
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.613225781; Fold-change: -0.019963654; Z-score: -0.066927588
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.883162099; Fold-change: 0.006782493; Z-score: 0.045556713
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.381208916; Fold-change: 0.060442261; Z-score: 0.189849858
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.636996324; Fold-change: 0.166044243; Z-score: 0.562005631
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.778782182; Fold-change: -0.040490231; Z-score: -0.321868282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.892089363; Fold-change: 0.037811036; Z-score: 0.150491041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000829838; Fold-change: -0.186395495; Z-score: -0.386784642
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.052847397; Fold-change: -0.238837613; Z-score: -0.755303112
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.932424825; Fold-change: 0.021218124; Z-score: 0.133882358
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022898234; Fold-change: 0.218821346; Z-score: 0.886676704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004498651; Fold-change: 0.253946882; Z-score: 2.71723071
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.839524142; Fold-change: 0.081136261; Z-score: 0.235384511
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128109677; Fold-change: 0.006004097; Z-score: 0.023183487
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.193605266; Fold-change: -0.079471712; Z-score: -0.231655976
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.87480477; Fold-change: -0.222162379; Z-score: -0.326976682
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.047838929; Fold-change: -0.091024338; Z-score: -0.329744543
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.16E-09; Fold-change: 0.147290911; Z-score: 0.656823383
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.54341535; Fold-change: 0.212432919; Z-score: 0.678707348
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.401505969; Fold-change: -0.098796576; Z-score: -0.311608157
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.199490185; Fold-change: 0.127024326; Z-score: 0.665399644
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020203978; Fold-change: -0.109194409; Z-score: -0.33029258
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.370937053; Fold-change: -0.046331664; Z-score: -0.144799041
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.517306926; Fold-change: 0.099714494; Z-score: 0.362052252
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.015486846; Fold-change: 0.148541988; Z-score: 0.593334159
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.378295562; Fold-change: 0.004266959; Z-score: 0.016876422
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.65749431; Fold-change: -0.038719532; Z-score: -0.268058287
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.360186681; Fold-change: 0.102356584; Z-score: 0.644707326
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.109704656; Fold-change: 0.272521296; Z-score: 1.425219173
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.488227597; Fold-change: 0.03816999; Z-score: 0.247442167
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.83E-12; Fold-change: -0.284009568; Z-score: -1.615236704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013144696; Fold-change: 0.187453415; Z-score: 1.125424117
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.41886689; Fold-change: -0.036696632; Z-score: -0.133777534
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.565150435; Fold-change: -0.066686991; Z-score: -0.275237546
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.088682767; Fold-change: 0.328882611; Z-score: 1.133004081
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046440867; Fold-change: -0.368176819; Z-score: -0.553994845
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.573128814; Fold-change: -0.060399684; Z-score: -0.209283304
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.291197678; Fold-change: 0.068086079; Z-score: 0.276046231
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.2034344; Fold-change: 0.005306277; Z-score: 0.029266669
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.372979213; Fold-change: -0.030995272; Z-score: -0.199055071
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.297050366; Fold-change: -0.340645003; Z-score: -0.850792706
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.369714639; Fold-change: -0.003665534; Z-score: -0.014098975
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.597467251; Fold-change: -0.019240482; Z-score: -0.050224782
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.742837748; Fold-change: 0.017887332; Z-score: 0.088761654
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.6839406; Fold-change: 0.179025419; Z-score: 0.533774929
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005520943; Fold-change: -0.071109321; Z-score: -0.4136568
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.67014568; Fold-change: 0.017729083; Z-score: 0.044067523
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.70667679; Fold-change: -0.000460051; Z-score: -0.003514891
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.116387965; Fold-change: 0.300147544; Z-score: 1.09135371
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.94E-05; Fold-change: -0.272955904; Z-score: -1.803002735
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.341267963; Fold-change: -0.142279671; Z-score: -0.907706293
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Recombinant anti-cd30 antibodies and uses thereof; 2006-02-02
Ref 2	Development of Novel Quaternary Ammonium Linkers for Antibody-Drug Conjugates. Mol Cancer Ther. 2016 May;15(5):938-45. doi: 10.1158/1535-7163.MCT-16-0038. Epub 2016 Mar 4.
Ref 3	Glucuronide-Linked Antibody-Tubulysin Conjugates Display Activity in MDR(+) and Heterogeneous Tumor Models. Mol Cancer Ther. 2018 Aug;17(8):1752-1760. doi: 10.1158/1535-7163.MCT-18-0073. Epub 2018 Jun 4.
Ref 4	Antitumor activity of anti-CD30 immunotoxin (Ber-H2/saporin) in vitro and in severe combined immunodeficiency disease mice xenografted with human CD30+ anaplastic large-cell lymphoma. Blood. 1995 Apr 15;85(8):2139-46.
Ref 5	Site-Specific Conjugation of Monomethyl Auristatin E to Anti-CD30 Antibodies Improves Their Pharmacokinetics and Therapeutic Index in Rodent Models. Mol Pharm. 2015 Jun 1;12(6):1863-71. doi: 10.1021/mp500666j. Epub 2015 Feb 9.
Ref 6	Development of Novel Antibody-Camptothecin Conjugates. Mol Cancer Ther. 2021 Feb;20(2):329-339.
Ref 7	Modified taxols .6. preparation of water-soluble prodrugs of taxol. J Nat Prod. 1991;54(6):1607-1611.
Ref 8	A phase I weekly dosing study of brentuximab vedotin in patients with relapsed/refractory CD30-positive hematologic malignancies. Clin Cancer Res. 2012 Jan 1;18(1):248-55.
Ref 9	Conjugation of DM1 to anti-CD30 antibody has potential antitumor activity in CD30-positive hematological malignancies with lower systemic toxicity. MAbs. 2019 Aug/Sep;11(6):1149-1161. doi: 10.1080/19420862.2019.1618674. Epub 2019 Jun 4.
Ref 10	Compact hydrophilic electrophiles enable highly efficacious high DAR ADCs with excellent in vivo PK profile. Chem Sci. 2023 Jan 3;14(9):2259-2266. doi: 10.1039/d2sc05678j. eCollection 2023 Mar 1.
Ref 11	Innovative Bioconjugation Technology for Antibody-Drug Conjugates: Proof of Concept in a CD30-Positive Lymphoma Mouse Model. Bioconjug Chem. 2021 Mar 17;32(3):595-606. doi: 10.1021/acs.bioconjchem.1c00058. Epub 2021 Feb 25.
Ref 12	Binding protein drug conjugates comprising anthracycline derivatives; 2016-06-30.
Ref 13	Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof; 2020-04-02.
Ref 14	Immunomodulatory antibody-drug conjugates; 2022-07-21.
Ref 15	Highly Potent, Anthracycline-based Antibody-Drug Conjugates Generated by Enzymatic, Site-specific Conjugation. Mol Cancer Ther. 2017 May;16(5):879-892.
Ref 16	Beta-glucuronide-linker drug conjugates; 2007-10-25.
Ref 17	Methylene carbamate linkers for use with targeted-drug conjugates; 2015-06-25.
Ref 18	Incorporation of Hydrophilic Macrocycles Into Drug-Linker Reagents Produces Antibody-Drug Conjugates With Enhanced in vivo Performance. Front Pharmacol. 2022 Jun 17;13:764540. doi: 10.3389/fphar.2022.764540. eCollection 2022.
Ref 19	Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 20	Antitumor effects of ricin A chain immunotoxins prepared from intact antibodies and Fab' fragments on solid human Hodgkin's disease tumors in mice. Cancer Res. 1990 May 15;50(10):2929-35.
Ref 21	A novel enediyne-integrated antibody-drug conjugate shows promising antitumor efficacy against CD30(+) lymphomas. Mol Oncol. 2018 Mar;12(3):339-355. doi: 10.1002/1878-0261.12166. Epub 2018 Jan 26.
Ref 22	Indicative announcement on obtaining clinical trial approval for recombinant anti-CD30 human-mouse chimeric monoclonal Antibody-MCC-DM1 injection; 18 Jul 2018.
Ref 23	https://tubulis.com/
Ref 24	Research programme: CD30 targeting antibody drug conjugate therapeutics-NBE Therapeutics.
Ref 25	AVIPEP Therapeutics product pipeline