General Information of This Antibody (ID: ANI0HIDZC)
Antibody Name
Brentuximab
Organization
Seagen Inc.
Indication
Neoplasms
Synonyms
Brentuximab; cAC30
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Chimeric IgG1-kappa
Antigen Name
Tumor necrosis factor receptor superfamily member 8 (TNFRSF8)
 Antigen Info 
ChEMBI ID
CHEMBL1742994
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QIQLQQSGPEVVKPGASVKISCKASGYTFTDYYITWVKQKPGQGLEWIGWIYPGSGNTKY
NEKFKGKATLTVDTSSSTAFMQLSSLTSEDTAVYFCANYGNYWFAYWGQGTQVTVSAAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKVLIYAASNLES
GIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Antibody Function Brentuximab vedotin binds to CD30, becomes internalized, and releases MMAE, which causes apoptosis as an antitubulin agent.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Brentuximab vedotin [Approved in 2011]
Identified from the Human Clinical Data
Click To Hide/Show 51 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Two-year Progression-Free Survival (PFS)
97.30 (BV-AVD group); 92.60 (ABVD group) %
Patients Enrolled
34 patients with previously untreated classical Hodgkin lymphoma (cHL).
Administration Dosage
After 2 cycles of Brentuximab vedotin, doxorubicin, dacarbazine combination therapy.
Related Clinical Trial
NCT Number NCT02505269  Clinical Status Phase 2
Clinical Description
Brentuximab vedotin plus ad in non-bulky limited stage Hodgkin lymphoma.
Primary Endpoint
For patients with high total metabolic tumor volume, the 2-year PFS rate was 90.90% and 70.70% in the BV-AVD and ABVD arms, respectively. 82.30% in the BV-AVD arm were PET-negative compared with 75.40% in the ABVD arm.
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Objective Response Rate (ORR)
59%
Patients Enrolled
Eastern Cooperative Oncology Group performance status 2 with previously untreated CD30-positive PTCL (CD30 detected in 10% of neoplastic cells by local review.
Administration Dosage
Patients were treated with six or eight 21-day cycles of either brentuximab vedotin, cyclophosphamide, doxorubicin, prednisone (A+CHP) or cyclophosphamide, doxorubicin, vincristine, prednisone (CHOP).
Related Clinical Trial
NCT Number NCT01777152  Clinical Status Phase 3
Clinical Description
A randomized, double-blind, placebo-controlled, phase 3 study of brentuximab vedotin and CHP (A+CHP) versus CHOP in the frontline treatment of patients with CD30-positive mature T-cell lymphomas.
Primary Endpoint
The median PFS = 62.30 months (95% CI: 42.00 months to not evaluable) for A+CHP. The median PFS = 23.80 months (95% CI: 13.60-60.80 months) for CHOP.
Other Endpoint
5-year overall survival (OS) rates = 70.10% (95% CI: 63.30% to 75.90%) with A+CHP VS 61.00% (95% CI: 54.00% to 67.30%) with CHOP (hazard ratio = 0.72; 95% CI: 0.53-0.99), The PFS HR = 0.55 (95% CI: 0.39-0.79; P = 0.0009) in the subset of patients with sALCL, and the estimated 5-year PFS = 60.60% (95% CI: 49.50% to 69.90%) for A+CHP,the estimated 5-year PFS= 48.40% (95% CI: 39.60% to 56.70%) for CHOP The ORR with first subsequent therapy on the A+CHP arm = 42.00% (27.00% CR) VS The ORR with first subsequent therapy = 42.00% (19.00% CR) in the CHOP armCR=72.57% (82/113) in the A+CHP arm were in CR at EOT, and = 30.49% (25/82) underwent consolidative SCT.

   Click to Show/Hide
Experiment 3 Reporting the Activity Date of This ADC [4]
Efficacy Data Objective Response Rate (ORR)
60%
Positive CD30 expression (CD30+++/++)
Patients Enrolled
Relapsed or progressive Hodgkin lymphoma (HL).
Administration Dosage
1.8 mg/kg IV once every 3 weeks for up to 16 cycles.
Related Clinical Trial
NCT Number NCT01100502  Clinical Status Phase 3
Clinical Description
A phase 3 study of brentuximab vedotin (SGN-35) in patients at high risk of residual Hodgkin lymphoma following stem cell transplant (the AETHERA trial).
Primary Endpoint
Objective response rate=60.00% (including 4 complete responses, 2 partial responses, 1 stable disease, 1 progressive disease, and 2 unknown).
Other Endpoint
5-year PFS=59.00% (95% CI 51.00-66.00).
Experiment 4 Reporting the Activity Date of This ADC [5]
Efficacy Data Objective Response Rate (ORR)
60.13%
Patients Enrolled
Elapsed or refractory classical Hodgkin lymphoma with measurable disease and an Eastern Cooperative Oncology Group performance status of 0 or 1 who were ineligible for or had relapsed after autologous haematopoietic stem-cell transplantation (HSCT).
Administration Dosage
1.80 mg/kg intravenously every 3 weeks.
Related Clinical Trial
NCT Number NCT02684292  Clinical Status Phase 3
Clinical Description
A phase 3, randomized, open-label, clinical trial to compare pembrolizumab with brentuximab vedotin in subjects with relapsed or refractory classical hodgkin lymphoma.
Primary Endpoint
Median progression-free survival = 13.20 months (95% CI 10.90-19.40) for pembrolizumab vs median progression-free survival = 8.30 months (5.70-8.80) for brentuximab vedotin (hazard ratio 0.65 [95% CI 0.48-0.88].; p=0.0027).
Other Endpoint
Objective responses (by investigator review) were recorded in 103 (68.21% [95% CI 60.1-75.5]) of 151 patients in the pembrolizumab group (40 [26.48%] complete responses and 63 [41.72%] partial responses), and in 92 (60.13% [51.9-67.9]) of 153 patients in the brentuximab vedotin group (36 [23.53%] complete responses and 56 [36.60%] partial responses).

   Click to Show/Hide
Experiment 5 Reporting the Activity Date of This ADC [6]
Efficacy Data Objective Response Rate (ORR)
0%
Positive CD30 expression (CD30+++/++)
Patients Enrolled
Histologically confirmed diagnoses of advSM (ASM, SM-AHN, or MCL).
Administration Dosage
1.8 mg/kg IV every 3 weeks up to 8 cycles.
Related Clinical Trial
NCT Number NCT01807598  Clinical Status Phase 2
Clinical Description
Brentuximab vedotin in treating patients with advanced systemic mastocytosis or mast cell leukemia.
Primary Endpoint
Objective response rate=0.00%.
Other Endpoint
Median progression-free survival=210 days (95% CI 77-343 days).
Experiment 6 Reporting the Activity Date of This ADC [7]
Efficacy Data Objective Response Rate (ORR)
8%
Positive CD30 expression (CD30+++/++)
Patients Enrolled
CD30-expressing nonlymphomatous cancer, not have been treated with chemotherapy, radiotherapy, biologics.
Administration Dosage
1.8 or 2.4 mg/kg BV once every three weeks.
Related Clinical Trial
NCT Number NCT01461538  Clinical Status Phase 2
Clinical Description
Brentuximab vedotin in patients with CD30-positive nonlymphomatous malignancies.
Primary Endpoint
Objective response rate= 8.00% (95% CI 1.10, 28.00).
Other Endpoint
Median progression-free survival=2.10 months (95% CI 1.20- 2.80).
Experiment 7 Reporting the Activity Date of This ADC [8]
Efficacy Data Objective Response Rate (ORR)
13.33%
Negative Lewis Y expression (Lewis Y-); Positive CD30 expression (CD30+++/++)
Patients Enrolled
Relapsed/refractory CD30+ primary mediastinal large B-cell lymphoma (PmLBCL).
Administration Dosage
1.80 mg per kg as a single IV infusion on day 1 of each 21-day cycle.
Related Clinical Trial
NCT Number NCT02423291  Clinical Status Phase 2
Clinical Description
A phase 2 study of SGN-35 (Brentuximab Vedotin) of patients with relapsed or refractory primary mediastinal large B-cell lymphoma (PmLBCL).
Primary Endpoint
The ORR was 13.33% (2/15): 2 patients PR, 1 patient SD, and the remaining 12 patients PD.
Experiment 8 Reporting the Activity Date of This ADC [9]
Efficacy Data Objective Response Rate (ORR)
36.40%
Negative Lewis Y expression (Lewis Y-); Positive CD30 expression (CD30+++/++)
Patients Enrolled
Any subtype of histologically confirmed high-CD30expressing non Hodgkin lymphoma (NHL), except anaplastic large-cell lymphoma (ALCL). High CD30 expression was defined as membranous CD30 expression in 30% of tumor cells detectable by visual assessment of routine immunohistochemistry staining using the anti-CD30 antibody on biopsy at the time of diagnosis or relapse. (2) A bidimensionally measurable lesion 1.5 cm in the greatest transverse diameter. (3) Age 20-75 years and an Eastern Cooperative Oncology Group performance status of 2. (4) Adequate bone marrow and organ function. (5) No history of another active cancer within the previous 5 years except basal cell carcinoma. Note that patients who had relapsed after autologous stem cell transplantation (SCT) were considered eligible. Exclusion criteria were: undergoing allogeneic SCT; active infection, human immunodeficiency virus infection, or hepatitis B or C; and lymphomatous involvement of the central nervous system. The 30% cutoff was established by consensus during an investigation initiation meeting of the pathologists from each of the study sites after they reviewed various cutoff values for positive and strong positive of CD30 expression across various subtypes of NHL.

   Click to Show/Hide
Administration Dosage
Intravenously at 1.80 mg/kg every 3 weeks and the primary endpoint was > 40% disease control rate.
Related Clinical Trial
NCT Number NCT02280785  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin for relapsed/refractory CD30-positive non-Hodgkin lymphomas other than anaplastic large cell lymphoma.
Primary Endpoint
For 1.80 mg/kg BV intravenously, the overall disease control rate was 48.48% (16/33).
Other Endpoint
For 1.80 mg/kg BV intravenously, the median PFS and OS 1.90 months and 6.10 months.
Experiment 9 Reporting the Activity Date of This ADC [10]
Efficacy Data Objective Response Rate (ORR)
41.18
54.00 %
Patients Enrolled
Relapsed/refractory CD30+ non-Hodgkin lymphomas; at least 1 prior systemic therapy, measurable disease, age 12 years, and Eastern Cooperative Oncology Group (ECOG) performance status of 2.
Administration Dosage
1.80 mg/kg was administered every 3 weeks until progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT01421667  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin in relapsed or refractory non-hodgkin lymphoma (NHL).
Primary Endpoint
In 34 evaluable patients, ORR was 41.18% (8 CRs, 6 PRs,and ORR was 54.00% in AITL (5 CRs, 2 PRs) with median PFS of 6.70 months thus far.
Other Endpoint
Median baseline sCD30 for patients with AITL and PTCL-NOS was 1214 ng/mL (range, 108-9473 ng/mL) and 840 ng/mL, respectively. Median duration of response for all patients was 7.60 months (range, 1.30-14.10 months), 5.50 months for AITL patients,and 7.60 months (range, 1.40-10.11 months) for PTCL-NOS patients.
Experiment 10 Reporting the Activity Date of This ADC [11]
Efficacy Data Objective Response Rate (ORR)
48%
Positive CD30 expression (CD30+++/++; FACS analysis = 495)
Patients Enrolled
EBV-positive and CD30- positive non-Hodgkin lymphomas with various levels of CD30 in the relapsed or refractory setting.
Administration Dosage
1.80 mg/kg brentuximab vedotin intravenously every 3 weeks for up to 16 cycles or until disease progression.
Related Clinical Trial
NCT Number NCT02388490  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin in patients with relapsed or refractory EBV-and CD30-positive lymphomas.
Primary Endpoint
For 1.80 mg/kg BV intravenously, the ORR was 48.00% (90% CI: 31.00%-64.00%).
Other Endpoint
For 1.80 mg/kg BV intravenously, Median Progression-Free Survival (mPFS)= 6.20 months (95% CI: 2.90-13.60), overall survival(mOS)=15.70 months (95% CI: 6.10-not reached).
Experiment 11 Reporting the Activity Date of This ADC [12]
Efficacy Data Objective Response Rate (ORR)
52.94%
Positive CD30 expression (CD30+++/++; FACS analysis = 116)
Patients Enrolled
Elderly patients with relapsed/refractory Hodgkin lymphoma (R/R HL).
Administration Dosage
1.80 mg/kg administered as a single outpatient intravenous infusion on Day 1 of each 21-day treatment cycle, for a maximum of 16 cycles.
Related Clinical Trial
NCT Number NCT02227433  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin (BV) in the treatment of elderly Hodgkin lymphoma (HL) patients at first relapse or with primary refractory disease.
Primary Endpoint
The efficacy of single agent BV was measured by overall objective response rate (ORR, sum of CR and partial response [PR] rates),Best response was reached at fourth cycle of BV therapy. ORR was 52.94% (9 of 17 patients) with a CR rate of 23.5% (4 of 17 patients).
Other Endpoint
Secondary endpoints were CR rate, disease free survival (DFS), 1-year PFS, 1-year OS and safety and tolerability of BV. With a median follow-up of 24.90 months, median PFS was 8.80 months and median OS was 21.70 months.
Experiment 12 Reporting the Activity Date of This ADC [13]
Efficacy Data Objective Response Rate (ORR)
67.86
60.00
87.50 %
Patients Enrolled
Patients who previously experienced a CR or PR with brentuximab vedotin, discontinued treatment while in remission, and subsequently experienced disease progression or relapse. Patients who received an allogeneic stem cell transplant (SCT) were eligible if they were >100 days from transplant and had no evidence of cytomegalovirus by polymerase chain reaction.

   Click to Show/Hide
Administration Dosage
1.80 mg/kg intravenously approximately every 3 weeks over 30 minutes as an outpatient infusion.
Related Clinical Trial
NCT Number NCT00947856  Clinical Status Phase 2
Clinical Description
Treatment with SGN-35 in patients with CD30-positive hematologic malignancies who have previously participated in an SGN-35 study.
Primary Endpoint
The ORR for HL and systemic ALCL retreatment patients was 67.86% (95% CI; 47.60-84.10),with a CR rate of 39.29% (95% CI; 21.50-59.40). The ORR was 60.00% (30.00% CR) for HL patients and 87.50% (62.50% CR) for systemic ALCL patients. The majority of patients (81.00%) who received brentuximab vedotin retreatment experienced reduction in measurable tumor volume.

   Click to Show/Hide
Other Endpoint
The objective response rate = 60.00% (30.00% CR) in HL patients and 87.50% (62.50% CR) in systemic ALCL patients.
Experiment 13 Reporting the Activity Date of This ADC [14]
Efficacy Data Objective Response Rate (ORR)
71%
Patients Enrolled
Relapsed or refractory Hodgkin lymphoma (HL) after auto-stem cell transplant.
Administration Dosage
1.80 mg/kg IV once every 3 weeks over 30 minutes on an outpatient basis for up to 16 infusions.
Related Clinical Trial
NCT Number NCT00848926  Clinical Status Phase 2
Clinical Description
A pivotal study of SGN-35 in treatment of patients with relapsed or refractory hodgkin lymphoma (HL).
Primary Endpoint
OrR = 72.00% (33.00% CR, 38.00% PR).
Other Endpoint
The estimated median DOR of PR in the 73 patients= 11.20 months (95% CI: 7.70, 18.70), The median DOR of CR in the 34 patients = not been reached (95% CI: 20.50 months, ). The estimated median OS for all patients was 40.50 months (95% CI: 28.70, ). The estimated 3-year OS for the 34 patients with a CR to brentuximab vedotin was 73.00% (95% CI: 57%, 88%). The estimated median PFS for all patients was 9.30 months (95% CI: 7.10, 12.20). Three-year PFS was estimated at 58.00% (95% CI: 41.00%, 76.00%) for the 34 CR patients.

   Click to Show/Hide
Experiment 14 Reporting the Activity Date of This ADC [15]
Efficacy Data Objective Response Rate (ORR)
75%
Patients Enrolled
Relapsed or refractory Hodgkin lymphoma (HL) after high-dose chemotherapy and auto-stem cell transplant, histologically documented CD30-positive Hodgkin's Reed-Sternberg cells by central pathology review.
Administration Dosage
1.80 mg/kg by intravenous infusion every 3 weeks; received a maximum of 16 cycle.
Related Clinical Trial
NCT Number NCT00848926  Clinical Status Phase 2
Clinical Description
A pivotal study of SGN-35 in treatment of patients with relapsed or refractory hodgkin lymphoma (HL).
Primary Endpoint
Tumor reductions were observed in 94% of patients. The ORR was 75.00% (95% CI, 64.90% to 82.60%); 34% of all patients achieved a CR (95% CI, 25.20% to 44.40%), and the overall disease control rate (CR + partial remission + stable disease) was 96% (95% CI, 90.30% to 98.90%). The median time to objective response was 5.70 weeks (range, 5.10 to 56 weeks),and the median time to CR was 12 weeks (range, 5.10 to 56 weeks).

   Click to Show/Hide
Other Endpoint
For patients who had an objective response,the median duration of response was 6.70 months (95% CI,3.60 to 14.80 months). The median duration of response for patients who achieved a CR was 20.50 months (95% CI,10.80 months to not estimable).
Experiment 15 Reporting the Activity Date of This ADC [16]
Efficacy Data Objective Response Rate (ORR)
86%
Patients Enrolled
Relapsed or refractory systemic anaplastic large cell lymphoma (ALCL) after treatment failure of at least one prior therapy with curative intent, the most common being a combination of cyclophosphamide, doxorubicin, vincristine, and prednisone.
Administration Dosage
1.80 mg/kg was administered intravenously once every 3 weeks over 30 minutes on an outpatient basis for up to 16 total doses.
Related Clinical Trial
NCT Number NCT00866047  Clinical Status Phase 2
Clinical Description
A phase 2 study of SGN-35 in treatment of patients with relapsed or refractory systemic anaplastic large cell lymphoma (ALCL).
Primary Endpoint
The ORR per independent review was 86.00% (95% CI,74.60% to 93.90%); 57% of patients achieved CR (95% CI, 43.20% to 69.80%), and 29.00% achieved partial remission. Tumor reductions were observed in 97.00% of patients.
Other Endpoint
The estimated median PFS time per independent review was 13.30 months (95% CI,6.90 months to NE); in the subset of patients who achieved a CR,the median PFS was 14.60 months. Per investigator assessment,the median PFS with brentuximab vedotin was 14.30 months (95% CI,9.10 months to NE). The median OS had not yet been reached. The estimated 12-month survival rate was 70.00%.

   Click to Show/Hide
Experiment 16 Reporting the Activity Date of This ADC [17]
Efficacy Data Objective Response Rate (ORR)
92.31%
Patients Enrolled
Patients were aged 60 years with classical HL (ie, patients with nodular lymphocyte predominant HL [NLPHL] were excluded). Patients were treatment nave and were either ineligible for frontline conventional combination treatment of HL (eg, ABVD or bleomycin, etoposide, doxorubicin, cyclophosphamide, vincristine, procarbazine, and prednisone [BEACOPP]) in the investigators judgment or had declined the available chemotherapy options after being informed of the potential benefits and risks.

   Click to Show/Hide
Administration Dosage
1.80 mg/kg of IV brentuximab vedotin every 3 weeks for up to 16 doses.
Related Clinical Trial
NCT Number NCT01716806  Clinical Status Phase 2
Clinical Description
A phase 2 open-label study of brentuximab vedotin in front-line therapy of Hodgkin lymphoma (HL) an dCD30-expressing peripheral t-cell lymphoma (PTCL) in older patients or patients with significant comorbidities ineligible for standard chemotherapy.
Primary Endpoint
The ORR among the 26 efficacy-evaluable patients was 92.31% (n=24, 95% CI 74.90-99.10). The median duration of objective response was 9.10 months (range 2.80-20.90 months) for all responder.
Other Endpoint
The CR among the 26 efficacy-evaluable patients was 73.08% (n=19, 95% CI 52.20-88.40), The median PFS was 10.50 months (range 2.61-22.31 months) for all efficacy evaluable patients and 11.80 months (range 4.10-22.31months) for CR.
Experiment 17 Reporting the Activity Date of This ADC [18]
Efficacy Data Objective Response Rate (ORR)
100%
High CD30 expression (CD30+++)
Patients Enrolled
35 patients with R/R Hodgkin lymphoma (HL).
Administration Dosage
Any time before on-protocol consolidation (nivolumab + BV; BV + bendamustine).
Related Clinical Trial
NCT Number NCT02927769  Clinical Status Phase 2
Clinical Description
Risk-based, response-adapted, phase II open-label trial of nivolumab + brentuximab vedotin (N + BV) for children, adolescents, and young adults with relapsed/refractory (R/R) CD30 + classic hodgkin lymphoma (cHL) after failure of first-line therapy, followed by brentuximab + bendamustine (BV + B) for participants with a suboptimal response (checkmate 744: checkpoint pathway and nivolumab clinical trial evaluation)

   Click to Show/Hide
Experiment 18 Reporting the Activity Date of This ADC [19]
Efficacy Data Objective Response Rate (ORR)
100%
Positive CD30 expression (CD30 +++/++)
Patients Enrolled
Patients with previously untreated, early-stage unfavorable Hodgkin lymphoma.
Administration Dosage
Patients were randomly assigned (2:1) to four cycles of BV-AVD or standard doxorubicin, bleomycin, vincristine, and dacarbazine (ABVD), followed by 30 Gy involved node radiotherapy.
Related Clinical Trial
NCT Number NCT02292979  Clinical Status Phase 2
Clinical Description
Brentuximab vedotin associated with chemotherapy in untreated patients with stage I/II unfavourable hodgkin lymphoma. a randomized phase ii lysa-fil-eortc intergroup study.
Primary Endpoint
CRR was 94.12% (32/34).
Other Endpoint
ORR was 100.00% (34/34).
Experiment 19 Reporting the Activity Date of This ADC [20]
Efficacy Data Objective Response Rate (ORR)
100%
Patients Enrolled
Had treatment-naive classical HL (excluding nodular lymphocyte predominant HL), fluorodeoxyglucose positron emission tomography (PET)-avid disease, bidimensional measurable disease of >=1.5 cm in the greatest transverse diameter, and an ECOG performance status of <=3 and were ineligible for or declined standard frontline chemotherapies (eg, ABVD or bleomycin, etoposide, Adriamycin, cyclophosphamide, Oncovin, procarbazine, and prednisone).

   Click to Show/Hide
Administration Dosage
1.80 mg/kg BV and 375 mg/m2 DTIC for up to 12 cycles, and 20 more patients received 1.80 mg/kg BV plus 90 or 70 mg/m2 bendamustine for up to 6 cycles (dose reduced due to toxicity).
Related Clinical Trial
NCT Number NCT01716806  Clinical Status Phase 2
Clinical Description
A phase 2 open-label study of brentuximab vedotin in front-line therapy of hodgkin lymphoma (HL) an dCD30-expressing peripheral t-cell lymphoma (PTCL) in older patients or patients with significant comorbidities ineligible for standard chemotherapy.
Primary Endpoint
For efficacy-evaluable patients treated with BV plus DTIC (n = 21), the ORR was 100.00%. For efficacy-evaluable patients treated with BV plus bendamustine (n = 17), the ORR was also 100.00%.
Other Endpoint
For efficacy-evaluable patients treated with BV plus DTIC (n = 21), the CR rate was 62.00%. At the time of this analysis, the median observation time from first dose was 21.60 months (range, 14.80 to 29.00 months), and median PFS was 17.90 months (range, 4.20 to 29.00 months). For efficacy-evaluable patients treated with BV plus bendamustine (n = 17), the CR was also 88.00%. Out of 7 patients (57.00%) with B symptoms at baseline had resolution. The median observation time from first dose was 10.80 months (range, 2.90 to 18.20 months). Neither the median PFS (range, 2.90 to 18.00 months) nor the median OS (range, 2.90 to 18.20 months) was reached at the time of this analysis.

   Click to Show/Hide
Experiment 20 Reporting the Activity Date of This ADC [21]
Efficacy Data Objective Response Rate (ORR)
60.71
78.38 %
Patients Enrolled
Relapsed/refractory CD30+ biopsy proven Hodgkin lymphoma (HL) or anaplastic large cell lymphoma (ALCL) and an ECOG Performance Status 2.
Administration Dosage
Bv was escalated from 1.20 mg/kg Day 1, and B from 70 mg/m2 Days 1 and 2 every 21 days until the MTD or recommended phase 2 dose (RP2D) was reached;Bv escalating to a dose of 1.80 mg/kg and B was escalated to 90 mg/m2.
Related Clinical Trial
NCT Number NCT01657331  Clinical Status Phase 1/2
Clinical Description
A phase 1/2 clinical trial of the combination of brentuximab vedotin and bendamustine in patients with relapsed or refractory hodgkin lymphoma or anaplastic large cell lymphoma.
Primary Endpoint
The MTD was not reached, based on the fact there was no maximum administrable dose identified. The RP2D was Bv at 1.80 mg/kg and B at 9.00 mg/kg. Only 1 of 11 patients qualified as a DLT (Grade 4 neutropenia) at the RP2D.
Other Endpoint
17 of 28 (ORR 60.71%, 95% CI 41.00-79.00) of patients achieved a response in the Phase 1, with 5 of 28 (17.86%) being CR. In the Phase 2, 29 of 37 (ORR 78.38%, 95% CI 62.00-91.00) patients responded, with 16 of 37 (43.24%) attaining a CR.
Experiment 21 Reporting the Activity Date of This ADC [22]
Efficacy Data Objective Response Rate (ORR)
50%
Positive CD30 expression (CD30+++/++; FACS analysis = 102)
Patients Enrolled
Patients had relapsed or refractory, histologically confirmed CD30-positive hematologic cancers. Patients with Hodgkin's lymphoma had received systemic chemotherapy either as induction therapy for advanced-stage disease or salvage therapy after initial radiotherapy for early-stage disease and had previously undergone autologous stem cell transplant (ASCT).

   Click to Show/Hide
Administration Dosage
Intravenously at doses of 0.10 to 3.60 mg per kilogram of body weight every 3 weeks (one cycle).
Related Clinical Trial
NCT Number NCT00430846  Clinical Status Phase 1
Clinical Description
A phase 1 dose escalation study of SGN-35 in patients with relapsed/refractory CD30-positive hematologic malignancies.
Primary Endpoint
Safety profile of brentuximab vedotin =1.80 mg/kg.
Other Endpoint
Secondary objectives were to determine pharmacokinetic measures for the antibody-drug conjugate and MMAE, evaluate immunogenicity, and assess antitumor response.The median time to maximum concentration occurred immediately after infusion for the antibody-drug conjugate and approximately 2 to 3 days after infusion for MMAE. Steady-state pharmacokinetics for both the antibody-drug conjugate and MMAE occurred by approximately 21 days,consistent with the half-life estimates of 4 to 6 days and 3 to 4 days, respectively.

   Click to Show/Hide
Experiment 22 Reporting the Activity Date of This ADC [23]
Efficacy Data Objective Response Rate (ORR)
73.00
70.00 %
Patients Enrolled
R/R PMBL; had an Eastern Cooperative Oncology Group performance status of 0 to 1, had a CD30 expression level of 1% or greater in the tumor or tumor-infiltrating lymphocytes by local immunohistochemistry, and had 1 or more measurable sites of disease according to the Lugano 2014 classification.
Administration Dosage
Received nivolumab (240 mg intravenously) and BV (1.80 mg/kg intravenously) every 3 weeks until disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02581631  Clinical Status Phase 1
Clinical Description
A phase 1/ 2 study to evaluate the safety and preliminary efficacy of nivolumab in combination with brentuximab vedotin in subjects with relapsed refractory non hodgkin lymphomas with CD30 expression (checkmate 436: CHECK point pathway and nivolumab clinical trial evaluation 436).
Primary Endpoint
For nivolumab (240 mg intravenously) and BV (1.8 mg/kg intravenously), ORR(95% CI) was 73.00% (54.00% to 88.00%), with a 37.00% complete remission rate per investigator, and ORR of 70.00% (51.00% to 85.00%), with a 43.00% complete metabolic response rate per independent review.
Other Endpoint
For nivolumab (240 mg intravenously) and BV (1.80 mg/kg intravenously), the 6-month PFS rate was 63.50% (95% CI, 42.50 to 78.60), and the 6-month OS rate was 86.30% (95% CI, 67.50 to 94.60). Median PFS and median OS were not reached.
Experiment 23 Reporting the Activity Date of This ADC [24]
Efficacy Data Objective Response Rate (ORR)
81.97
83.33 %
Patients Enrolled
Refractory Hodgkin lymphoma (defined as not achieving a CR to frontline therapy or progression within 3 months of CR), or Hodgkin lymphoma that had relapsed (defined as progression 3 months after CR to frontline therapy).
Administration Dosage
Received BV (1.80 mg/kg IV, 30-minute infusion) and Nivo (3.00 mg/kg IV, 60-minute infusion) in 3-week cycles for up to 12 weeks (4 cycles). During the first cycle, BV was administered on day 1 and Nivo on day 8. During cycles 2 to 4, BV and Nivo were administered on day 1, with Nivo given at least 30 minutes after BV.
Related Clinical Trial
NCT Number NCT02572167  Clinical Status Phase 1
Clinical Description
A phase 1/2 study evaluating brentuximab vedotin in combination with nivolumab in patients with relapsed or refractory Hodgkin lymphoma after failure of frontline therapy.
Primary Endpoint
Response rates and Deauville 5-point score for all treated patients (n = 61) and efficacy-evaluable patients (n = 60) are presented. The CR rate among all treated patients was 61.00% (95% CI,47.00%-73.00%). Among efficacy-evaluable patients,the CR rate was 62.00% (95% CI,48.00%-74.00%).
Other Endpoint
Response rates and Deauville 5-point score for all treated patients (n = 61) and efficacy-evaluable patients (n = 60) are presented. The ORR rate among all treated patients was 81.97% (95% CI, 70.00%-91.00%). Among efficacy-evaluable patients, the ORR rate was 83.33% (95% CI,72.00%-92.00%).
Experiment 24 Reporting the Activity Date of This ADC [25]
Efficacy Data Objective Response Rate (ORR)
85%
Patients Enrolled
Biopsy-proven primary refractory (ie, not achieving a CR or progression <3 months after CR) or relapsed Hodgkin lymphoma (HL; progression 3 months after CR).
Administration Dosage
Received up to 4 cycles of BV 1.80 mg/kg every 3 weeks IV over 30 minutes followed by Nivo 3.00 mg/kg IV over 60 minutes. In parts 1/2 (staggered dosing), BV was administered on day 1 and Nivo on day 8 of cycle 1, with both agents administered on day 1 during cycles 2 to 4. During part 2, the protocol was amended to mandate prophylactic treatment with steroids (hydrocortisone 100 mg or equivalent) and antihistamines (diphenhydramine 25-50 mg or equivalent) at day 1 of each cycle beginning at cycle 2. Patients in part 3 (same-day dosing) received both BV and Nivo on day 1 of all cycles, based on the interim efficacy and safety results in parts 1 and 2 of this study and encouraging results with same-day dosing of both agents in the Eastern Cooperative Oncology Group and the American College of Radiology Imaging Network (ECOG-ACRIN) study E4412.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT02572167  Clinical Status Phase 1
Clinical Description
A phase 1/2 study evaluating brentuximab vedotin in combination with nivolumab in patients with relapsed or refractory Hodgkin lymphoma after failure of frontline therapy.
Primary Endpoint
The objective response rate (ORR; N=91) = 85.00%, with 67.00% achieving a complete response (CR); progression-free survival (PFS) rate at 3 years = 77.00% (95% CI, 65.00% to 86.00%) and 91.00% (95% CI, 79.00% to 96.00%) for patients undergoing ASCT directly after study treatment.
Other Endpoint
OS= 93.00% (95% CI, 85.00% to 97.00%) at 3 years.
Experiment 25 Reporting the Activity Date of This ADC [26]
Efficacy Data Objective Response Rate (ORR)
100%
Positive CD30 expression (CD30+++/++)
Patients Enrolled
CD30 peripheral T-cell lymphoma.
Administration Dosage
1.8 mg/kg IV once every 3 weeks for 6 cycles.
Related Clinical Trial
NCT Number NCT01309789  Clinical Status Phase 1
Clinical Description
A phase 1 study of brentuximab vedotin given sequentially and combined with multi-agent chemotherapy for CD30-positive mature T-cell and NK-cell neoplasms.
Primary Endpoint
Objective response rate=100.00%.
Other Endpoint
5-year PFS= 52.00%; OS=80.00%
Experiment 26 Reporting the Activity Date of This ADC [27]
Efficacy Data Objective Response Rate (ORR)
73.00
86.00 %
Patients Enrolled
Hodgkin lymphoma who had relapsed after autologous stem cell transplant (ASCT); systemic anaplastic large-cell lymphoma (sALCL) who had previously been treated with curative intent.
Administration Dosage
1.80 mg/kg, i.v., once every 21 days; a maximum of 16 cycles.
Experiment 27 Reporting the Activity Date of This ADC [28]
Efficacy Data Objective Response Rate (ORR)
58.54%
Patients Enrolled
Relapsed or refractory, histologically confirmed CD30-positive hematologic malignancies with bi-dimensional measurable disease of at least 1.5 cm by radiographic evaluation. Patients with Hodgkin lymphoma had received systemic chemotherapy as induction therapy for advanced-stage disease or salvage therapy after initial radiotherapy for early-stage disease and had previously undergone autologous stem cell transplantation (ASCT) unless they were ineligible for or had declined treatment. Patients with other CD30-positive malignancies had previously failed or were refractory to front-line chemotherapy. Patients who had transformed to systemic anaplastic large cell lymphoma (ALCL) were eligible.

   Click to Show/Hide
Administration Dosage
Intravenously on Days 1, 8, and 15, of each 28-day cycle at doses ranging from 0.40 to 1.40 mg/kg.
Experiment 28 Reporting the Activity Date of This ADC [29]
Efficacy Data Complete Remission (CR)
35%
Patients Enrolled
Histologically confirmed rel/ref de novo or transformed diffuse large B-cell lymphoma (DLBCL) after at least 1 prior therapy, Eastern Cooperative Oncology Group (ECOG) performance status 2, and adequate organ function as defined in supplemental Methods.
Administration Dosage
The treatment cycle was 21 days with intravenous BV administered on day 1 and Len administered on days 1 to 21 for a maximum of 16 cycles, the maximum tolerated dose of the combination was 1.20 mg/kg BV with 20 mg/d Len.
Related Clinical Trial
NCT Number NCT04404283  Clinical Status Phase 3
Clinical Description
A randomized, double-blind, placebo-controlled, active-comparator, multicenter, phase 3 study of brentuximab vedotin or placebo in combination with lenalidomide and rituximab in subjects with relapsed or refractory diffuse large B-cell lymphoma (DLBCL).
Primary Endpoint
The maximum tolerated dose of the combination was 1.20 mg/kg BV with 20 mg/d lenalidomide.
Other Endpoint
The overall response rate was 57.00% (95% CI, 39.60-72.50), complete response rate, 35.00% (95% CI, 20.70-52.60); median duration of response, 13.10 months; median progression-free survival, 10.20 months (95% CI, 5.50-13.70); and median overall survival, 14.30 months (95% CI, 10.20-35.60).
Experiment 29 Reporting the Activity Date of This ADC [30]
Efficacy Data Complete Remission (CR)
61.54%
Patients Enrolled
Previously untreated, histologically confirmed stage III/IV classical Hodgkin lymphoma (cHL).
Administration Dosage
A+AVD (brentuximab vedotin, 1.20 mg/kg of bodyweight, doxorubicin 25 mg/m2 of body surface area, vinblastine 6 mg/m2, and dacarbazine 375 mg/m2) or ABVD (doxorubicin 25 mg/m2, bleomycin 10 U/m2, vinblastine 6 mg/m2, and dacarbazine 375 mg/m2) intravenously on days 1 and 15 of each 28-day cycle for up to six cycles.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01712490  Clinical Status Phase 3
Clinical Description
A randomized, open-label, phase 3 trial of A+AVD versus ABVD as frontline therapy in patients with advanced classical hodgkin lymphoma.
Primary Endpoint
For 1.20 mg/kg BV intravenously, the 3-year PFS rates=83.10% (95% CI, 79.90-85.90) in the A+AVD arm.
Other Endpoint
For 1.20 mg/kg BV intravenously, complete resolution(CR)=61.54% of (272/442) in the A+AVD arm.
Experiment 30 Reporting the Activity Date of This ADC [31]
Efficacy Data Complete Remission (CR)
71.33%
Patients Enrolled
Previously untreated patients (18 years with an Eastern Cooperative Oncology Group performance status of 2) with stage III or IV classical Hodgkin lymphoma.
Administration Dosage
A+AVD (brentuximab vedotin, 1.20 mg/kg of bodyweight, doxorubicin 25 mg/m2 of body surface area, vinblastine 6 mg/m2, and dacarbazine 375 mg/m2) or ABVD (doxorubicin 25 mg/m2, bleomycin 10 U/m2, vinblastine 6 mg/m2, and dacarbazine 375 mg/m2) intravenously on days 1 and 15 of each 28-day cycle for up to six cycles.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01712490  Clinical Status Phase 3
Clinical Description
A randomized, open-label, phase 3 trial of A+AVD versus ABVD as frontline therapy in patients with advanced classical hodgkin lymphoma.
Primary Endpoint
For 1.20 mg/kg BV intravenously, 5-year PFS rates=82.20% (95% CI 79.00-85.00) with A+AVD.
Other Endpoint
For 1.20 mg/kg BV intravenously, complete resolution(CR)=71.33% of (31.6/44.3) of patients with peripheral neuropathy in the A+AVD arm. Peripheral neuropathy occurred in 443 (66.91%) of 662 patients in the A+AVD group.
Experiment 31 Reporting the Activity Date of This ADC [32]
Efficacy Data Complete Remission (CR)
12%
Patients Enrolled
Part (A) relapsed/refractory CD30-expressing mature T-cell and B-cell non-Hodgkin lymphomas (NHL), including DLBCL; Part (B) brentuximab vedotin plus rituximab in relapsed/refractory CD30-expressing DLBCL; and Part (C) single-agent brentuximab vedotin in relapsed/refractory CD30u DLBCL.
Administration Dosage
1.80 mg/kg was administered IV every 21 days.
Related Clinical Trial
NCT Number NCT01421667  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin in relapsed or refractory non-hodgkin lymphoma (NHL).
Primary Endpoint
ORR=31.00%, median duration=4.70 months (range 0.50-11.60) for 16 patients enrolled on Part C.
Other Endpoint
Six patients had CR (12.00%) with a median duration of 11.60 months (range,1.40+ - 11.60) and median PFS of 15.60 months (range,3.8+ - 15.6). Overall median PFS was 1.4 months (range, 0.40- 15.60). Median overall survival (OS) was 7.50 months (range, 0.7-18.6).
Experiment 32 Reporting the Activity Date of This ADC [33]
Efficacy Data Complete Remission (CR)
35.41%
Patients Enrolled
A clinical and histologically confirmed diagnosis of CD30+ LyP, CD30+ pc-anaplastic large-cell lymphoma (ALCL), or myelofibrosis (MF). Eastern Cooperative Oncology Group performance status of 2 and adequate bone marrow and organ function were required.
Administration Dosage
Intravenously at 1.80 mg/kg every 21 days for a maximum of eight doses.
Related Clinical Trial
NCT Number NCT01352520  Clinical Status Phase 2
Clinical Description
Phase 2 trial of brentuximab vedotin (SGN-35) at dose of 1.80 mg/kg IV every 3 weeks in patients with CD30-positive lymphoproliferative disorders (cutaneous anaplastic large T-cell lymphoma (ALCL), mycosis fungoides, and extensive lymphomatoid papulosis (LyP).
Primary Endpoint
Os rate=72.92% (95% CI, 60.00% to 86.00%; 35 of 48 patients), CR raate=35.41% (95% CI, 22.00% to 49.00%; 17 of 48 patients). Fifteen (53.57%; 95% CI, 31% to 59%) of 28 patients with MF responded, independent of CD30 expression.
Other Endpoint
In patients with MF/Szary syndrome, the overall response rate was 50.00% (five of 10 patients) in patients with low CD30 expression (< 10%), 58.33% (seven of 12 patients) in patients with medium expression (10% to 50%), and 50.00% (three of six patients) in patients with high expression (50%).
Experiment 33 Reporting the Activity Date of This ADC [34]
Efficacy Data Complete Remission (CR)
43%
Patients Enrolled
Patients over 10 years of age with biopsy-proven cHL that had relapsed or was primary refractory (lack of CR or PD within 3months of upfront therapy) after standard initial therapy were eligible.
Administration Dosage
1.80 mg/kg intravenously every 3 weeks for two cycles.
Related Clinical Trial
NCT Number NCT01393717  Clinical Status Phase 2
Clinical Description
A phase 2 study of brentuximab vedotin as salvage therapy for hodgkin lymphoma prior to autologous hematopoietic stem cell transplantation.
Primary Endpoint
The 2-year PFS among patients in CR at the time of AHCT (n=37) was 71% compared with 54% in patients not in CR (p=0.12). The 2-year PFS in patients who proceeded to AHCT directly after receiving BV alone was 77%.
Other Endpoint
Of 56 evaluable patients treated across cohorts, the overall response rate (ORR) to second-line BV was 75.00% with 43.00% CR.
Experiment 34 Reporting the Activity Date of This ADC [1]
Efficacy Data Complete Remission (CR)
58%
Patients Enrolled
LyP and were also required to have scarring, more than 10 lesions, or active lesions on the face, hands, or feet.
Administration Dosage
Intravenous brentuximab vedotin 1.80 mg/kg infused over 30 minutes every 21 days.
Related Clinical Trial
NCT Number NCT01352520  Clinical Status Phase 2
Clinical Description
Phase 2 trial of brentuximab vedotin (SGN-35) at dose of 1.80 mg/kg IV every 3 weeks in patients with CD30-positive lymphoproliferative disorders (cutaneous anaplastic large T-cell lymphoma (ALCL), mycosis fungoides, and extensive lymphomatoid papulosis (LyP).
Primary Endpoint
The overall response rate was 100% and at 4 months was 80% (8 of 10 patients).
Experiment 35 Reporting the Activity Date of This ADC [35]
Efficacy Data Complete Remission (CR)
14.70%
Patients Enrolled
Steroid-refractory acute graft-versus-host disease (SR-aGVHD).
Administration Dosage
The study included weekly dosing for 3 weeks followed by maintenance dosing every 3 weeks for an 4 additional doses. A standard 3+3 dose-escalation cohort (0.60 mg/kg, 0.90 mg/kg, and 1.20 mg/kg) was planned to define the maximum tolerated dose (MTD). After treating the first 6 patients, the study was revised to dosing every 2 weeks for 4 doses only for safety purposes, and to enroll cohorts of 5 patients at each dose level (0.60 mg/kg, 0.80 mg/kg, 1.00 mg/kg, and 1.20 mg/kg).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01940796  Clinical Status Phase 1
Clinical Description
Phase 1 trial of brentuximab vedotin for refractory chronic graft-vs.-host disease (GVHD).
Primary Endpoint
The MTD was defined at 0.80 mg/kg with one DLT observed (sepsis).
Other Endpoint
At day 28, the overall response rate was 38.20% with 5 complete responses (CR, 14.70%) and 8 very good partial responses (VGPR, 23.50%).Overall survival was 41.00% (95% CI, 25.00%-57.00%) at 6 months and 38.00% (95% CI, 22.00%-54.00%) at 12 months.
Experiment 36 Reporting the Activity Date of This ADC [36]
Efficacy Data Complete Remission (CR)
35%
Patients Enrolled
Relapsed or refractory diffuse large B-cell lymphoma (DLBCL); have previously received at least two lines of therapy, including rituximab and an anthracycline; patients had either had a relapse after or were ineligible for autologous transplantation.
Administration Dosage
1.20 mg/kg intravenously (IV) on Day 1 of every 21 day cycle.
Related Clinical Trial
NCT Number NCT02086604  Clinical Status Phase 1
Clinical Description
A phase 1 trial of brentuximab vedotin in combination with lenalidomide in relapsed or refractory diffuse large B-cell lymphoma.
Primary Endpoint
Most patients required granulocyte colony-stimulating factor support because of neutropenia. The overall response rate was 57.00% (95% CI, 39.60-72.50), complete response rate, 35.00% (95% CI, 20.70-52.60); median duration of response, 13.10 months; median progression-free survival, 10.20 months (95% CI, 5.50-13.70); and median overall survival, 14.30 months (95% CI, 10.20-35.60). Response rates were highest in patients with CD301 DLBCL (73.00%), but they did not differ according to cell of origin (P=5.96).

   Click to Show/Hide
Experiment 37 Reporting the Activity Date of This ADC [37]
Efficacy Data Complete Remission (CR)
66.67%
Patients Enrolled
Primary refractory Hodgkin Lymphoma or early relapse. Eligibility criteria included age 30 years; no prior Brentuximab vedotin exposure; and relapse <1 year from completion of initial therapy.
Administration Dosage
Each 21-day cycle consisted of intravenous day 1 at 1.40 mg/kg or 1.80 mg/kg.
Related Clinical Trial
NCT Number NCT01780662  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of brentuximab vedotin (SGN35) in combination with gemcitabine for pediatric and young adult patients with relapsed or refractory Hodgkin lymphoma.
Primary Endpoint
For four of the 13 patients with stable disease or partial response,all target lesions were Deauville score 3 on central review,and would thus be considered CRs by response criteria published after AHOD1221 opened. By these criteria,the complete response rate observed on AHOD1221 was 28 of 42 patients (66.67%; 95% CI, 51.00-80.00%).
Experiment 38 Reporting the Activity Date of This ADC [38]
Efficacy Data Complete Remission (CR)
74%
Patients Enrolled
First relapse or primary refractory classic Hodgkin lymphoma (CHL) after one prior line of therapy.
Administration Dosage
Days 1 and 8 at either 1.20 or 1.50 mg/kg IV (capped at 150 mg) with standard dosing of ICE on days 13 for two cycles.
Related Clinical Trial
NCT Number NCT02227199  Clinical Status Phase 1
Clinical Description
A phase 1/2 trial of brentuximab vedotin (BV), ifosfamide (I), carboplatin (C), and etoposide (E) for patients with relapsed or refractory Hodgkin lymphoma (BV-ICE).
Primary Endpoint
Rp2D=BV 1.50 mg/kg IV CR=74.00%.
Other Endpoint
ORR=91.00%.
Experiment 39 Reporting the Activity Date of This ADC [39]
Efficacy Data Complete Remission (CR)
86%
Patients Enrolled
CD30+ primary mediastinal large B-cell lymphoma (PMBCL), diffuse large B-cell lymphoma (DLBCL), or gray zone lymphoma (GZL). Patients with any stage, measurable disease, and an Eastern Cooperative Oncology Group Performance Status of 3 or less were eligible. The diagnostic biopsy had to demonstrate at least 1% or higher expression of CD30 on the lymphoma B cells by immunohistochemistry and was assessed independently by two pathologists. Patients with active central nervous system involvement and uncontrolled systemic infections were excluded.

   Click to Show/Hide
Administration Dosage
Six cycles of BV (1.80 mg/kg, maximum dose of 180 mg) administered with the R-CHOP regimen without vincristine, including: rituximab 375 mg/m2, cyclophosphamide 750 mg/m2, and doxorubicin 50 mg/m2 on day 1 and prednisone 100 mg (or equivalent) daily on days 1 through 5 of each 21-day cycle. For cycle 1, rituximab was split into two doses (100 mg/m2 on day 1 and 275 mg/m2 on day 2) to reduce risks of an infusion reaction to rituximab.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01994850  Clinical Status Phase 1
Clinical Description
A phase 1/2 study of brentuximab vedotin in combination with multi-agent chemotherapy as front-line treatment in patients with CD30 positive primary mediastinal large B-cell, diffuse large B-cell, and grey zone lymphomas.
Primary Endpoint
For Brentuximab vedotin dose of 1.80 mg/kg, the overall response rate was 100.00% (95%CI: 88.00-100.00) with 86.00% (95% CI: 68.00-96.00) of patients achieving complete response at the end of systemic treatment.
Other Endpoint
For Brentuximab vedotin dose of 1.80 mg/kg, the 2-year PFS and overall survival rates were 85.00% (95%CI: 66.00-94.00) and 100.00%, respectively.
Experiment 40 Reporting the Activity Date of This ADC [40]
Efficacy Data Complete Remission (CR)
95.45
96.00 %
Patients Enrolled
Newly diagnosed, treatment-naive, CD30-positive patients with Hodgkin's lymphoma who had histologically confirmed stage IIA bulky disease or stage IIB-IV disease and an Eastern Cooperative Oncology Group performance status of two or less.
Administration Dosage
0.60, 0.90, or 1.20 mg/kg brentuximab vedotin by intravenous infusion every 2 weeks with either ABVD (25 mg/m(2) doxorubicin, 10 units/m(2) bleomycin, 6 mg/m(2) vinblastine, and 375 mg/m(2) dacarbazine) or AVD (ABVD modified regimen without the inclusion of bleomycin) for up to six cycles.
Related Clinical Trial
NCT Number NCT01060904  Clinical Status Phase 1
Clinical Description
A phase 1 dose-escalation safety study of brentuximab vedotin in combination with multi-agent chemotherapy as frontline therapy in patients with Hodgkin lymphoma.
Primary Endpoint
The MTD of brentuximab vedotin 1.20 mg/kg ; CR of brentuximab vedotin + ABVD = 95.45%(21/22); CR of brentuximab vedotin + AVD = 96.00%(24 /25 ).
Other Endpoint
Maximum tolerated dose was not exceeded at 1.20 mg/kg of brentuximab vedotin combined with either ABVD or AVD.
Experiment 41 Reporting the Activity Date of This ADC [41]
Efficacy Data Complete Remission (CR)
60%
Patients Enrolled
Had prior solid organ or hematopoietic stem cell transplantation, received immunosuppressive therapy for a nonmalignant condition, and/or had an aggressive EBV+lymphoid malignancy.
Administration Dosage
Induction therapy consisted of R 375 mg/m2 given on days 1, 8, 15, 22, and BV 1.20 mg/kg given on days 1, 8, 15, followed by restaging as assessed by CT imaging. MT consisted of BV 1.8 mg/kg every 3 weeks and R 375 mg/m2 every 6 weeks for up to one year of total therapy.
Experiment 42 Reporting the Activity Date of This ADC [42]
Patients Enrolled
Patients aged 18 years with previously treated CD30-expressing myelofibrosis (MF) or classic anaplastic large-cell lymphoma (after at least 1 prior systemic therapy or prior radiotherapy) were enrolled; CD30 positivity was defined as 10% of target lymphoid cells exhibiting a membrane, cytoplasmic, and/or Golgi staining pattern for CD30. An Eastern Cooperative Oncology Group performance status of 0 to 2 was required.

   Click to Show/Hide
Administration Dosage
Brentuximab vedotin (1.80 mg/kg IV every 3 weeks, for up to 16 cycles) or physicians choice (methotrexate, 5-50 mg orally once weekly or bexarotene 300 mg/m2 [target dose] orally once daily, for up to 48 weeks).
Related Clinical Trial
NCT Number NCT01578499  Clinical Status Phase 3
Clinical Description
A previously treated, recurrent or metastatic cervical cancer (SGN-35) versus physician's choice (methotrexate or bexarotene) in patients with CD30-positive cutaneous T-cell lymphoma.
Primary Endpoint
For 1.80 mg/kg BV intravenously, objective responses lasting 4 months (ORR4) was 54.70%; the ORR per IRF was 65.60%.
Other Endpoint
For 1.80 mg/kg BV intravenously, the CR rate was 17.20%; median PFS 16.70 (95% CI, 0.25-0.58); 3-year estimates of OS was 64.40% (95% CI, 0.42-1.32); time to next treatment (TTNT) was 14.20 (95% CI, 0.17-0.42).
Experiment 43 Reporting the Activity Date of This ADC [43]
Patients Enrolled
Advanced classic Hodgkins lymphoma (Ann Arbor stage III or IV, as determined on a 4-point scale, with higher stages indicating more widespread disease),17 according to the World Health Organization classification system. Patients who had not been previously treated with systemic chemotherapy or radiotherapy were eligible. Patients were required to have an Eastern Cooperative Oncology Group performance status of 0, 1, or 2 (on a scale of 0 to 5, with higher scores indicating greater disability).

   Click to Show/Hide
Administration Dosage
A+AVD (1.20 mg of brentuximab vedotin per kilogram of body weight, 25 mg of doxorubicin per square meter of body-surface area, 6 mg of vinblastine per square meter, and 375 mg of dacarbazine per square meter) or ABVD (25 mg of doxorubicin per square meter, 10 units of bleomycin per square meter, 6 mg of vinblastine per square meter, and 375 mg of dacarbazine per square meter) intravenously on days 1 and 15 of each 28-day cycle for up to 6 cycles.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01712490  Clinical Status Phase 3
Clinical Description
A randomized, open-label, phase 3 trial of A+AVD versus ABVD as frontline therapy in patients with advanced classical Hodgkin lymphoma.
Primary Endpoint
After a median follow-up of 24.90 months (range, 0 to 49.30), the rate of the primary end point of independently determined modified progression-free survival was significantly higher in the A+AVD group than in the ABVD group (2-year modified progression-free survival rate, 82.10% [95% confidence interval {CI}, 78.70 to 85.00] vs. 77.20% [95% CI, 73.70 to 80.40]; hazard ratio for progression, death, or modified progression, 0.77 [95% CI, 0.60 to 0.98]; P = 0.03), corresponding to a 23.00% risk reduction.

   Click to Show/Hide
Other Endpoint
The interim 2-year overall survival rate for the A+AVD group was 96.60% (95% CI,94.80 to 97.70) and that for the ABVD group was 94.90% (95% CI,92.90 to 96.40),which corresponded to a reduction in the risk of death of 28.00% in favor of the A+AVD regimen (hazard ratio,0.72; 95% CI,0.44 to 1.17; P = 0.19).
Experiment 44 Reporting the Activity Date of This ADC [44]
Patients Enrolled
CD30-positive mycosis fungoides or primary cutaneous anaplastic large-cell lymphoma who had been previously treated.
Administration Dosage
Interactive voice and web response system to receive intravenous brentuximab vedotin 1.80 mg/kg once every 3 weeks, for up to 16 3-week cycles.
Related Clinical Trial
NCT Number NCT01578499  Clinical Status Phase 3
Clinical Description
A randomized, open-label, phase 3 trial of brentuximab vedotin (SGN-35) versus physician's choice (methotrexate or bexarotene) in patients with CD30-positive cutaneous T-cell lymphoma.
Primary Endpoint
At a median follow-up of 22.90 months (95% CI 18.40-26.10), the proportion of patients achieving an objective global response lasting at least 4 months was 56.25% (36 of 64 patients) with brentuximab vedotin versus 12.50% (8/64) with physicians choice, resulting in a between-group difference of 43.80% (95% CI 29.10-58.40).
Other Endpoint
Median progression-free survival per EMA criteria was 16.70 months in the brentuximab vedotin group versus 3.50 months in the physicians choice group (HR 0.270, 95% CI 0.169-0.430).
Experiment 45 Reporting the Activity Date of This ADC [45]
Patients Enrolled
Previously untreated Hodgkins lymphoma of stage IIB with bulk tumor or stage IIIB, IVA, or IVB.
Administration Dosage
Brentuximab vedotin (at a dose of 1.80 mg per kilogram) plus doxorubicin, vincristine, etoposide, prednisone, and cyclophosphamide or the standard bleomycin-containing chemotherapy regimen was administered every 21 days.
Related Clinical Trial
NCT Number NCT02166463  Clinical Status Phase 3
Clinical Description
A randomized phase 3 study of brentuximab vedotin (SGN-35) for newly diagnosed high-risk classical hodgkin lymphoma (cHL) in children and young adults.
Primary Endpoint
At a median follow-up of 42.10 months (range, 0.10 to 80.90), the 3-year event-free survival was 92.10% (95% confidence interval [CI],88.40 to 94.70) in the brentuximab vedotin group.
Other Endpoint
Overall survival at 3 years was 99.30% (95% CI,97.30 to 99.80) in the brentuximab vedotin group.
Experiment 46 Reporting the Activity Date of This ADC [46]
Patients Enrolled
III or IV Hodgkins lymphoma.
Administration Dosage
1.20 mg of brentuximab vedotin per kilogram of body weight, 25 mg of doxorubicin per square meter of body-surface area, 6 mg of vinblastine per square meter, and 375 mg of dacarbazine per square meter; intravenously on days 1 and 15 of each 28-day cycle for up to six cycles.
Related Clinical Trial
NCT Number NCT01712490  Clinical Status Phase 3
Clinical Description
A randomized, open-label, phase 3 trial of A+AVD Versus ABVD as frontline therapy in patients with advanced classical hodgkin lymphoma.
Primary Endpoint
The analysis of overall survival significantly favored A+AVD over ABVD (95% CI,0.40-0.88).The 6-year overall survival estimates were 93.90% (95% CI,91.60 to 95.50) in the A+AVD group and 89.40% (95% CI,86.60 to 91.70) in the ABVD group.
Other Endpoint
The median follow-up in the overall survival analysis was 73.00 months (95% CI,72.30 to 73.60; range,0.0 to 100.6). A total of 39 deaths occurred in the A+AVD group and 64 in the ABVD group.
Experiment 47 Reporting the Activity Date of This ADC [47]
Patients Enrolled
46 patients with classic Hodgkin lymphoma, unsuitable for standard chemotherapy because of a cardiac ejection fraction of less than 50%, pulmonary diffusion capacity of less than 80%, or a creatinine clearance of 30 mL/min or more but less than 60 mL/minrequired to have an Eastern Cooperative Oncology Group (ECOG) performance status of 0-2.
Administration Dosage
Brentuximab vedotin (1.8 mg/kg, dose cap at 180 mg) and nivolumab (3 mg/kg) intravenously every 21 days for 8 cycles.
Related Clinical Trial
NCT Number NCT02758717  Clinical Status Phase 2
Clinical Description
Phase II, multi-center trial of nivolumab and brentuximab vedotin in patients with untreated Hodgkin lymphoma over the age of 60 years or unable to receive standard adriamycin, bleomycin, vinblastine, and dacarbazine (ABVD) chemotherapy.
Primary Endpoint
The overall response, defined as a partial metabolic response or complete metabolic response at the end of 8 cycles of treatment
Other Endpoint
The complete metabolic response rate, safety and tolerability of the regimen in this population, duration of response, progression-free survival, and overall survival.
Experiment 48 Reporting the Activity Date of This ADC [48]
Patients Enrolled
Metastatic non-seminomatous germ cell tumor (GCT) with the exception of pure teratoma who progressed after first-line cisplatin-based chemotherapy and after at least one salvage regimen.
Administration Dosage
1.80 mg/kg IV every 3 weeks until disease progression or intolerable toxicities.
Related Clinical Trial
NCT Number NCT01461538  Clinical Status Phase 2
Clinical Description
A phase 2, open-label study of brentuximab vedotin in patients with CD30-positive nonlymphomatous malignancies.
Primary Endpoint
For 1.80 mg/kg BV intravenously, Median PFS in the CD30 positive cohort was 1.20 months (95% CI: 0.90-2.10) and in the CD30 negative cohort was 1.40 months (95% CI: 0.00-2.10). Median OS in the CD30 positive cohort was 2.50 months (95% CI: 1.10-12.90) and in the CD30 negative cohort was 5.90 months (95% CI: 1.60-8.20).
Experiment 49 Reporting the Activity Date of This ADC [49]
Patients Enrolled
Histologically proven anaplastic lymphoma kinase (ALK)+ anaplastic large-cell lymphoma (ALCL) and were younger than 22 years of age at diagnosis.
Administration Dosage
Brentuximab vedotin was administered on day 1 of each of the 6 cycles for a total of 6 doses. The starting dose of brentuximab vedotin was 1.80 mg/kg (maximum dose, 180 mg) given IV over 30 minutes on day 1 of each cycle prior to all other chemotherapy. Dose reductions to 1.20 mg/kg (maximum dose, 120 mg), followed by 0.80 mg/kg (maximum dose, 80 mg), were mandated for certain toxicities.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01979536  Clinical Status Phase 2
Clinical Description
A randomized phase 2 trial of brentuximab vedotin (SGN35, NSC# 749710), or crizotinib (NSC#749005, commercially labeled) in combination with chemotherapy for newly diagnosed patients with anaplastic large cell lymphoma (ALCL).
Primary Endpoint
For 1.80 mg/kg BV intravenously, the complete response rate (complete response + complete response, unconfirmed) was 62.12% for patients who underwent evaluation after cycle 2 (41/66 patients) and 96.88% after cycle 6 (62/64 patients).
Other Endpoint
For 1.80 mg/kg BV intravenously, The 2-year event-free survival (EFS)=79.10% (95%CI, 67.20-87.10). The 2-year overall survival (OS)=97.00% (95% CI, 88.10-99.20).
Experiment 50 Reporting the Activity Date of This ADC [50]
Patients Enrolled
High-risk relapsed or refractory classic Hodgkin lymphoma, had an ECOG performance status of 0-2, and had adequate organ and bone marrow function.
Administration Dosage
Enrolled patients received brentuximab vedotin (1.8 mg/kg) intravenously starting 30-60 days after autologous HSCT on day 1 of each 21-day cycle for up to 8 cycles.
Related Clinical Trial
NCT Number NCT03057795  Clinical Status Phase 2
Clinical Description
A phase 2 study of nivolumab and brentuximab vedotin consolidation after autologous stem cell transplantation in patients with high-risk classical hodgkin lymphoma.
Primary Endpoint
The 18-month progression-free survival in all 59 patients was 94% (95% CI 84-98).
Other Endpoint
The 24-month overall survival was 98.00% (95% CI 88.00-100.00). The 24-month progression-free survival according to the number of risk factors was 94.00% (95% CI 67.00-99.00) in patients with one risk factor (n=21),96.00% (73.00-99.00) in patients with two risk factors (n=24), and 85.00% (51.00-96.00) in patients with three or more risk factors (n=14). The 24-month cumulative incidence of relapse and progression was 5.70% (95% CI 1.50-14.00); the 24-month cumulative incidence of non-relapse mortality was 1.80% (0.14-8.40).

   Click to Show/Hide
Experiment 51 Reporting the Activity Date of This ADC [51]
Related Clinical Trial
NCT Number NCT02686346  Clinical Status Phase 1/2
Clinical Description
Phase 1/2 feasibility study of brentuximab vedotin in refractory/relapsed hodgkin lymphoma patients who are treated by chemotherapy (ICE) in second line and eligible for autologous transplantation.
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 20 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [52]
Efficacy Data Tumor Growth Inhibition value (TGI)
0%
Positive CD30 expression (CD30+++/++)
Method Description
3 mg conjugate/kg/inj.
In Vivo Model L2987 cell line xenograft model
In Vitro Model Lung adenocarcinoma L2987 cells CVCL_H586
Experiment 2 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 28.40% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model L-540 cell line xenograft model
In Vitro Model Hodgkin lymphoma L-540 cells CVCL_1362
Experiment 3 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 31.50% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model KM-H2 cell line xenograft model
In Vitro Model Hodgkin lymphoma KM-H2 cells CVCL_1330
Experiment 4 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 51.70% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model KM-H2 cell line xenograft model
In Vitro Model Hodgkin lymphoma KM-H2 cells CVCL_1330
Experiment 5 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 53.40% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model KM-H2 cell line xenograft model
In Vitro Model Hodgkin lymphoma KM-H2 cells CVCL_1330
Experiment 6 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 65.80% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model L-540 cell line xenograft model
In Vitro Model Hodgkin lymphoma L-540 cells CVCL_1362
Experiment 7 Reporting the Activity Date of This ADC [53]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 74.70% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination Brentuximab Vedotin with TGR-1202 (PI3K- inhibitor) against cancer cell growth was evaluated in the HL xenograft model. Six- to eight-week-old NOD/SCID mice (20 to 25 g) were xenografted with L-540 (2.5x106 cells/mouse) and KM-H2 (2.0x106 cells/mouse) cells by inoculation into the left flank. When the tumor volume reached approximately 100 mg, the mice were randomly assigned to receive TGR-1202 (150 mg/kg/5 day/3 wks, PO) and/or BV (0.5 mg/kg/q4d/2 weeks, IP).

   Click to Show/Hide
In Vivo Model KM-H2 cell line xenograft model
In Vitro Model Hodgkin lymphoma KM-H2 cells CVCL_1330
Experiment 8 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 78.80% Positive CD30 expression (CD30+++/++)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. Mice of the ruxolitinib group received ruxolitinib at a dose of 50 mg/kg per day by s.c. inserted osmotic minipumps for 2 wk. Mice of the BV group received BV at 4 mg/kg by i.v. injection every 4 d for three injections. Mice of the combination group received a combination of ruxolitinb with BV at the same doses and dosing schedules as those in the ruxolitinib and BV groups.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 9 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 87.30% High CD30 expression (CD30+++)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib, Navitoclax, and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. The xenograft tumor model of human HL HDLM-2 was established by s.c. injection of 2x107 HDLM-2 cells into the right flank of female, 8-wk-old, NOD/SCID mice.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 10 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 92% Moderate CD30 expression (CD30++)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib, Navitoclax, and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. The xenograft tumor model of human HL HDLM-2 was established by s.c. injection of 2x107 HDLM-2 cells into the right flank of female, 8-wk-old, NOD/SCID mice.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 11 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 94.70% Negative CD30 expression (CD30-)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib, Navitoclax, and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. The xenograft tumor model of human HL HDLM-2 was established by s.c. injection of 2x107 HDLM-2 cells into the right flank of female, 8-wk-old, NOD/SCID mice.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 12 Reporting the Activity Date of This ADC [52]
Efficacy Data Tumor Growth Inhibition value (TGI)
96.83%
Positive CD30 expression (CD30+++/++)
Method Description
1 mg conjugate/kg/inj.
In Vivo Model Karpas 299 ALCL cell line xenograft model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 13 Reporting the Activity Date of This ADC [52]
Efficacy Data Tumor Growth Inhibition value (TGI)
99.20%
Positive CD30 expression (CD30+++/++)
Method Description
0.5 mg/kg/in.
In Vivo Model Karpas 299 ALCL cell line xenograft model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 14 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.80% High CD30 expression (CD30+++)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. Mice of the ruxolitinib group received ruxolitinib at a dose of 50 mg/kg per day by s.c. inserted osmotic minipumps for 2 wk. Mice of the BV group received BV at 4 mg/kg by i.v. injection every 4 d for three injections. Mice of the combination group received a combination of ruxolitinb with BV at the same doses and dosing schedules as those in the ruxolitinib and BV groups.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 15 Reporting the Activity Date of This ADC [54]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.90% High CD30 expression (CD30+++)
Method Description
The inhibitory activity of all possible combination regimens of ruxolitinib, Navitoclax, and BV against cancer cell growth was evaluated in the HDLM-2 xenograft mouse model of human HL. The xenograft tumor model of human HL HDLM-2 was established by s.c. injection of 2x107 HDLM-2 cells into the right flank of female, 8-wk-old, NOD/SCID mice.

   Click to Show/Hide
In Vivo Model HDLM-2 cell line xenograft model
In Vitro Model Hodgkin lymphoma HDLM-2 cells CVCL_0009
Experiment 16 Reporting the Activity Date of This ADC [55]
Efficacy Data Tumor Growth Delay (TGD)
40 Day
High CD30 expression (CD30+++)
Method Description
SCID mice were implanted with L540cy HL cells in the right flank. Groups of mice (9-10/group) were untreated or received SGN-35 (1 mg/kg, q4dx3, i.p.) and/or ABVD [Adriamycin (0.75 mg/kg, q4dx3, i.v.), Bleomycin (6u/kg, q4dx3, i.p.), Vinblastine (0.01 mg/kg, q4dx3, i.p.) and Dacarbazine (15 mg/kg, q3dx4, i.p.)] when tumour size averaged approximately 300 mm3.

   Click to Show/Hide
In Vivo Model L540cy cell line xenograft model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 17 Reporting the Activity Date of This ADC [55]
Efficacy Data Tumor Growth Delay (TGD)
62 Day
High CD30 expression (CD30+++/++)
Method Description
SCID mice were implanted with L540cy HL cells in the right flank. Groups of mice (9-10/group) were untreated or received SGN-35 (1 mg/kg, q4dx3, i.p.) and/or ABVD [Adriamycin (0.75 mg/kg, q4dx3, i.v.), Bleomycin (6u/kg, q4dx3, i.p.), Vinblastine (0.01 mg/kg, q4dx3, i.p.) and Dacarbazine (15 mg/kg, q3dx4, i.p.)] when tumour size averaged approximately 300 mm3.

   Click to Show/Hide
In Vivo Model L540cy cell line xenograft model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 18 Reporting the Activity Date of This ADC [55]
Efficacy Data Tumor Growth Delay (TGD)
63 Day
High CD30 expression (CD30+++)
Method Description
SCID mice were implanted with L540cy HL cells in the right flank. Groups of mice (9-10/group) were untreated or received SGN-35 (1 mg/kg, q4dx3, i.p.) and/or ABVD [Adriamycin (0.75 mg/kg, q4dx3, i.v.), Bleomycin (6u/kg, q4dx3, i.p.), Vinblastine (0.01 mg/kg, q4dx3, i.p.) and Dacarbazine (15 mg/kg, q3dx4, i.p.)] when tumour size averaged approximately 100 mm3.

   Click to Show/Hide
In Vivo Model L540cy cell line xenograft model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 19 Reporting the Activity Date of This ADC [55]
Efficacy Data Tumor Growth Delay (TGD) > 80 Day Negative Lewis Y expression (Lewis Y-); Positive CD30 expression (CD30+++/++)
Method Description
SCID mice were implanted with L540cy HL cells in the right flank. Groups of mice (9-10/group) were untreated or received SGN-35 (1 mg/kg, q4dx3, i.p.) and/or ABVD [Adriamycin (0.75 mg/kg, q4dx3, i.v.), Bleomycin (6u/kg, q4dx3, i.p.), Vinblastine (0.01 mg/kg, q4dx3, i.p.) and Dacarbazine (15 mg/kg, q3dx4, i.p.)] when tumour size averaged approximately 100 mm3.

   Click to Show/Hide
In Vivo Model L540cy cell line xenograft model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 20 Reporting the Activity Date of This ADC [56]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
2.5 ng/mL
Method Description
The inhibitory activity of cAC10 vcMMAE against cancer cell growth was compared with other anti-CD30 mAbs against the growth of a variety of HD and ALCL cell lines in vitro. For localized, subcutaneous disease models of ALCL and HD,5x106 Karpas 299 or 2x107 L540cy cells, respectively, were implanted into the right flanks of C.B.-17/IcrHsd-SCID mice (Harlan, Indianapolis, IN).Therapy with cAC10-vcMMAE or controls was initiated when the tumor size in each group of 5 animals averaged approximately 100 mm3.Treatment consisted of intravenous injections every fourth day for 4 injections (q4d x 4).

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Revealed Based on the Cell Line Data
Click To Hide/Show 12 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.9 pM
Method Description
The inhibitory activity of Brentuximab vedotin against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
6.7 pM
Method Description
The inhibitory activity of Brentuximab vedotin against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Hodgkin lymphoma L-540 cells CVCL_1362
Experiment 3 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
14.2 pM
Method Description
The inhibitory activity of Brentuximab vedotin against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Experiment 4 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
14.5 pM
Method Description
The inhibitory activity of Brentuximab vedotin against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Anaplastic large cell lymphoma SU-DHL-1 cells CVCL_0538
Experiment 5 Reporting the Activity Date of This ADC [58]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.5 ng/mL
Method Description
The inhibitory activity of the mAb-Val-Cit-MMAE conjugates exhibited greater in vitrospecificity and lower in vivo toxicity was compared with corresponding hydrazone conjugatescorresponding hydrazone conjugates on H3396 cells.The cytotoxic effects of the conjugates on H3396 cells (cBR96 Ag+,cAC10 Ag-) were determined using both pulsed (2 h) and long-term(97 h) drug exposure assays.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 6 Reporting the Activity Date of This ADC [59]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
6 ng/mL
Method Description
The inhibitory activity of the mAb-Val-Cit-MMAE conjugates exhibited greater in vitrospecificity and lower in vivo toxicity was compared with corresponding hydrazone conjugatescorresponding hydrazone conjugates on H3396 cells.The cytotoxic effects of the conjugates on H3396 cells (cBR96 Ag+,cAC10 Ag-) were determined using both pulsed (2 h) and long-term(97 h) drug exposure assays.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia CESS cells CVCL_0209
Experiment 7 Reporting the Activity Date of This ADC [59]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
63 ng/mL
Method Description
The inhibitory activity of the mAb-Val-Cit-MMAE conjugates exhibited greater in vitrospecificity and lower in vivo toxicity was compared with corresponding hydrazone conjugatescorresponding hydrazone conjugates on H3396 cells.The cytotoxic effects of the conjugates on H3396 cells (cBR96 Ag+,cAC10 Ag-) were determined using both pulsed (2 h) and long-term(97 h) drug exposure assays.

   Click to Show/Hide
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 8 Reporting the Activity Date of This ADC [59]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
90 ng/mL
Method Description
The inhibitory activity of the mAb-Val-Cit-MMAE conjugates exhibited greater in vitrospecificity and lower in vivo toxicity was compared with corresponding hydrazone conjugatescorresponding hydrazone conjugates on H3396 cells.The cytotoxic effects of the conjugates on H3396 cells (cBR96 Ag+,cAC10 Ag-) were determined using both pulsed (2 h) and long-term(97 h) drug exposure assays.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma KM-H2 cells CVCL_1330
Experiment 9 Reporting the Activity Date of This ADC [60]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
219.5 ng/mL
Method Description
The inhibitory activity of Brentuximab Vedotin against cancer cell growth was evaluated in CD30positive GCT27 cell line in vitro. The cells were treated with 250 ng/mL ADC for 96 hours.
In Vitro Model Testicular teratoma GCT 27 cells CVCL_A344
Experiment 10 Reporting the Activity Date of This ADC [60]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1013 ng/mL
Method Description
The inhibitory activity of Brentuximab Vedotin against cancer cell growth was evaluated in CD30negative JAR cell line in vitro. The cells were treated with 1000 ng/mL ADC for 96 hours.
In Vitro Model Gestational choriocarcinoma JAR cells CVCL_0360
Experiment 11 Reporting the Activity Date of This ADC [60]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1400.8 ng/mL
Method Description
The inhibitory activity of Brentuximab Vedotin against cancer cell growth was evaluated in moderate expression NCCIT cell line in vitro. The cells were treated with 500 ng/mL ADC for 96 hours.
In Vitro Model Testicular embryonal carcinoma NCC-IT cells CVCL_1451
Experiment 12 Reporting the Activity Date of This ADC [61]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3300.00
1.30
9.90 ng/mL
ng/mL
ng/mL
Method Description
The antitumor activity of SGN-35 was prepared with 14C-labeled MMAE. Intracellular ADC activation on CD30+ and negative cell lines was determined using a combination of radiometric and liquid chromatograhpy/mass spectrometry-based assays. The bystander activity of SGN-35 was determined using mixed tumor cell cultures consisting of CD30+ and CD30 lines.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Diffuse large B-cell lymphoma WSU-NHL cells CVCL_1793
Hodgkin's disease L540cy cells Homo sapiens
F0002-ADC [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [62]
Patients Enrolled
Eligibility criteria require: ECOG 0-1; centrally confirmed relapsed/refractory CD30+ malignancies (prioritizing cHL, ALCL, MF); &ge;1 measurable lesion (nodal &ge;15mm/extranodal &ge;10mm, skin nodules for MF); adequate hematologic/organ function (Hb&ge;80g/L, NEUT&ge;1.5&times;10<sup>9</sup>/L, etc.); washout periods (&ge;8 weeks post-transplant, &ge;4 weeks post-therapy [6 weeks for alkylators]); life expectancy >3 months; and voluntary informed consent.

   Click to Show/Hide
Administration Dosage
Every 21 days for 1 cycle, continue treatment until a maximum 16 cycles. Dose Escalating: 0.3 - 4.8 mg/kg
Related Clinical Trial
NCT Number NCT03894150  Clinical Status PHASE1
Clinical Description
A Dose-Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of F0002-ADC in Chinese Patients With Refractory or Recurrent CD30+ Hematologic Malignancies.
Primary Endpoint
The primary endpoint is MTD (maximum tolerable dose) assessed within 21 days following a single dose administration.
Other Endpoint
Secondary endpoints include ORR (objective response rate), DOR (duration of response), and PFS (progression-free survival) evaluated every 2 cycles (21-day cycles) until tumor progression/death/3 years; pharmacokinetic parameters (Cmax, AUC, Tmax, T1/2, CL, Vd) and immunogenicity (Anti-F0002-ADC antibodies) measured 1 month post-final dose; with safety monitoring for adverse events and laboratory abnormalities until 1 month post-treatment.

   Click to Show/Hide
SGN-35T [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [63]
Patients Enrolled
Eligible participants require histologically confirmed lymphoid malignancies (Parts A/B: CD30+ &ge;1% except cHL/ALCL; Part C: CD30-independent) with specific prior therapy requirements: cHL (&ge;3 lines, anti-PD-1 exposed), PTCL (&ge;2 lines), or ALCL (brentuximab-containing regimens). Key exclusions: >2 brentuximab lines, recent malignancies (<3 years), active CNS disease, allogeneic SCT complications (<100 days/GVHD/CMV reactivation), or significant pulmonary conditions (Grade&ge;2 ILD, steroid-dependent lung disease). ECOG&le;1 and measurable FDG-avid disease (per Lugano criteria) are mandatory.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06120504  Clinical Status PHASE1
Clinical Description
An Open-label Phase 1 Study to Evaluate the Safety of SGN-35T in Adults With Advanced Malignancies
Primary Endpoint
The safety assessment will track adverse events, laboratory abnormalities, dose modifications, and dose-limiting toxicities (including by dose level) through 30-37 days post-treatment (approximately 1 year). AE reporting will include all medically significant occurrences regardless of causality, with DLT evaluations specifically during the initial 21-day period.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic analysis will assess AUC, Cmax, and Tmax through 30-37 days post-treatment (≈1 year), summarized descriptively alongside antidrug antibody incidence. Efficacy endpoints include investigator-assessed ORR (CR+PR), CR rate, and DOR (time from first response to progression/death), all evaluated over ≈1 year using disease-specific criteria.

   Click to Show/Hide
CAC10-DT [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 9 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0% Low CD30 expression (CD30+)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-DT=3 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 2 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0% Low CD30 expression (CD30+)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-DT=1 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 3 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 72% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-DT=3 mg/kg.
In Vivo Model ALCL CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells/Karpas BVR cells CVCL_1324
Experiment 4 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-DT=10 mg/kg.
In Vivo Model ALCL CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells/Karpas BVR cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
7 ng/mL
High CD30 expression (CD30+++; 285,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Precursor T-cell acute lymphoblastic leukemia ALCL cells CVCL_A036
Experiment 6 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
16 ng/mL
High CD30 expression (CD30+++; 180,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Anaplastic large cell lymphoma DEL/BVR cells CVCL_1170
Experiment 7 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
26 ng/mL
High CD30 expression (CD30+++; 400,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 8 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Low CD30 expression (CD30+; 70,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 9 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL High CD30 expression (CD30+++; 320,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
CAC10-CPT-LC [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 54.80% Low CD30 expression (CD30+)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=1 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 2 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 72.65% Low CD30 expression (CD30+)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=3 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 3 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 76% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=0.3 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=10 mg/kg.
In Vivo Model ALCL CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells/Karpas BVR cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=3 mg/kg.
In Vivo Model ALCL CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells/Karpas BVR cells CVCL_1324
Experiment 6 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lc=1 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 7 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
High CD30 expression (CD30+++; 285,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Precursor T-cell acute lymphoblastic leukemia ALCL cells CVCL_A036
Experiment 8 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
High CD30 expression (CD30+++; 400,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Ovarian serous cystadenocarcinoma SK-OV-3 cells CVCL_0532
Experiment 9 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
2 ng/mL
High CD30 expression (CD30+++; 320,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 10 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3 ng/mL
High CD30 expression (CD30+++; 180,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Anaplastic large cell lymphoma DEL/BVR cells CVCL_1170
Experiment 11 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Low CD30 expression (CD30+; 70,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
CAC10-GT [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 67% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-GT=30mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 67% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-GT=10 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
20 ng/mL
High CD30 expression (CD30+++; 285,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Precursor T-cell acute lymphoblastic leukemia ALCL cells CVCL_A036
Experiment 4 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
27 ng/mL
High CD30 expression (CD30+++; 180,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Anaplastic large cell lymphoma DEL/BVR cells CVCL_1170
Experiment 5 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
79 ng/mL
High CD30 expression (CD30+++; 400,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 6 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
160 ng/mL
High CD30 expression (CD30+++; 320,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 7 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
850 ng/mL
Low CD30 expression (CD30+; 70,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
CAC10-CPT-LB [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 78% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. The dose of cAC10-CPT-Lb=0.3 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [64]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.80% Positive CD30 expression (CD30+++/++)
Method Description
Tumor cells, as suspensions, were implanted subcutaneously in SCID or nude mice. Upon tumor engraftment, mice were randomized to study groups (5 mice per group) when the average tumor volume reached about 100 mm3. The ADC or vehicle controls were dosed once via intraperitoneal injection. cAC10-CPT-Lb=1 mg/kg.
In Vivo Model HD CDX model
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
High CD30 expression (CD30+++; 285,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Precursor T-cell acute lymphoblastic leukemia ALCL cells CVCL_A036
Experiment 4 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
High CD30 expression (CD30+++; 320,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
High CD30 expression (CD30+++; 400,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 6 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3 ng/mL
High CD30 expression (CD30+++; 180,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Anaplastic large cell lymphoma DEL/BVR cells CVCL_1170
Experiment 7 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Low CD30 expression (CD30+; 70,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
WO2007011968A2 cAC10-9a [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [65]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
An in vivo therapy experiments with cAC10-9a was undertaken in nude mice with subcutaneous Karpas 299 ALCL tumors. The animals (5 per group)were treated with a single intravenous dose of cAC10-9a at 3 mg/kg (mAb component) on day 14.
In Vivo Model Karpas-299 CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [65]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
An in vivo therapy experiments with cAC10-9a was undertaken in nude mice with subcutaneous Karpas 299 ALCL tumors. The animals (5 per group)were treated with a single intravenous dose of cAC10-9a at 1 mg/kg (mAb component) on day 14.
In Vivo Model Karpas-299 CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [65]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
An in vivo therapy experiments with cAC10-9a was undertaken in nude mice with subcutaneous Karpas 299 ALCL tumors. The animals (5 per group)were treated with a single intravenous dose of cAC10-9a at 0.75 mg/kg (mAb component) on day 14.
In Vivo Model Karpas-299 CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.06 nM
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 50 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 3 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 55 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
CAC10-Gly5-MAY [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [66]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High CD30 expression (CD30+++)
Method Description
CD30 Karpas-299 cells were either transplanted subcutaneously into NSG, or into CB17.SCID mice. Mice were treated intravenously 3 times weekly with 1 mg/kg preparations, beginning one day post randomization, when the tumors had reached a size ranging between 100 and 150 mm3.
In Vivo Model Non-Hodgkin's lymphoma CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [66]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High CD30 expression (CD30+++)
Method Description
CD30 Karpas-299 cells were either transplanted subcutaneously into NSG, or into CB17.SCID mice. Mice were treated intravenously 3 times weekly with 10 mg/kg ADC preparations, beginning one day post randomization, when the tumors had reached a size ranging between 100 and 150 mm3.
In Vivo Model Non-Hodgkin's lymphoma CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [66]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.7 ng/mL
High CD30 expression (CD30+++)
Method Description
Briefly, cells were plated on 96-well plates in 75 uL growth medium and grown at 37°C in a humidified incubator in a 7.5% CO2 atmosphere. After one day incubation, 25 uL of 3.5-fold serial dilutions of each ADC in growth medium were added, typically resulting in final ADC concentrations from 20 ug/mL to 0.02 ng/mL.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
CAC10-Gly5-PNU [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [66]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High CD30 expression (CD30+++)
Method Description
CD30 Karpas-299 cells were either transplanted subcutaneously into NSG, or into CB17.SCID mice. Mice were treated intravenously 3 times weekly with 1 mg/kg preparations, beginning one day post randomization, when the tumors had reached a size ranging between 100 and 150 mm3.
In Vivo Model Non-Hodgkin's lymphoma CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [66]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High CD30 expression (CD30+++)
Method Description
CD30 Karpas-299 cells were either transplanted subcutaneously into NSG, or into CB17.SCID mice. Mice were treated intravenously 3 times weekly with 1 mg/kg preparations, beginning one day post randomization, when the tumors had reached a size ranging between 100 and 150 mm3.
In Vivo Model Non-Hodgkin's lymphoma CDX model
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [66]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.8 ng/mL
High CD30 expression (CD30+++)
Method Description
Briefly, cells were plated on 96-well plates in 75 uL growth medium and grown at 37°C in a humidified incubator in a 7.5% CO2 atmosphere. After one day incubation, 25 uL of 3.5-fold serial dilutions of each ADC in growth medium were added, typically resulting in final ADC concentrations from 20 ug/mL to 0.02 ng/mL.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [66]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.8 ng/mL
Negative CD30 expression (CD30-)
Method Description
Briefly, cells were plated on 96-well plates in 75 uL growth medium and grown at 37°C in a humidified incubator in a 7.5% CO2 atmosphere. After one day incubation, 25 uL of 3.5-fold serial dilutions of each ADC in growth medium were added, typically resulting in final ADC concentrations from 20 ug/mL to 0.02 ng/mL.
In Vitro Model B acute lymphoblastic leukemia Reh cells CVCL_1650
CAC10-CPT-LA [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3 ng/mL
High CD30 expression (CD30+++; 285,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Precursor T-cell acute lymphoblastic leukemia ALCL cells CVCL_A036
Experiment 2 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4 ng/mL
High CD30 expression (CD30+++; 180,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Anaplastic large cell lymphoma DEL/BVR cells CVCL_1170
Experiment 3 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Low CD30 expression (CD30+; 70,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 4 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL High CD30 expression (CD30+++; 320,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [64]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL High CD30 expression (CD30+++; 400,000 CD30 molecules/cell)
Method Description
Serial dilutions of ADCs in cell culture media were prepared at 4x working concentrations, and 50 uL of each dilution was added to the 96-well plates. Following addition of test articles, cells were incubated for 4 days at 37°C, after which growth inhibition was assessed by the addition of CellTiter-Glo and luminescence was measured on a plate reader.

   Click to Show/Hide
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Brentuximab-8 [Clinical candidate]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.6 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-8 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.5 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-8 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Hodgkin lymphoma L-540 cells CVCL_1362
Experiment 3 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.2 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-8 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Anaplastic large cell lymphoma SU-DHL-1 cells CVCL_0538
Experiment 4 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.1 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-8 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Brentuximab-7 [Clinical candidate]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.4 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-7 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
6.4 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-7 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Hodgkin lymphoma L-540 cells CVCL_1362
Experiment 3 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
10.2 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-7 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Experiment 4 Reporting the Activity Date of This ADC [57]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
10.5 pM
High CD30 expression (CD30+++)
Method Description
The inhibitory activity of Brentuximab-7 against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Anaplastic large cell lymphoma SU-DHL-1 cells CVCL_0538
Crown Ether ADC 4f [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
16 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 4d [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
16 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 6b [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
19 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 4e [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
19 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 4b [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
22 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 4c [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
28 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 5a [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
30 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 4a [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
30 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 6a [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
32 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Crown Ether ADC 5b [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [67]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
34 pM
Positive CD30 expression (CD30+++/++)
Method Description
Cells were incubated for 24 h at 37°C with 5% CO2. The cells were treated by addition of ADCs 4a-f, 5a-b and 6a-b, dilution series (50 uL/well) and were then incubated at 37°C/5% CO2 for a further 96 h. Cell viability assays were carried out using CellTiter-Glo Luminescent reagent as per the manufacturers instructions.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
WO2007011968A2 cAC10-9b [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.05 nM
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 50 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 3 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 50 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
WO2007011968A2 cAC10-17 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.2 nM
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 45 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 3 Reporting the Activity Date of This ADC [65]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 45 nM Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
WO2015095755A1 cAC10-2.0 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.4 ng/mL
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3 ng/mL
Positive CD30 expression (CD30+++/++); Low CD70 expression (CD70+)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
65 ng/mL
Moderate CD30 expression (CD30++); Low CD70 expression (CD70+)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 4 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Negative CD30 expression (CD30-); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
WO2015095755A1 cAC10-1.3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.8 ng/mL
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3 ng/mL
Positive CD30 expression (CD30+++/++); Low CD70 expression (CD70+)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
Experiment 4 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
WO2015095755A1 cAC10-1006 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1 ng/mL
Positive CD30 expression (CD30+++/++); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
8 ng/mL
Positive CD30 expression (CD30+++/++); Low CD70 expression (CD70+)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Negative CD30 expression (CD30-); Negative CD70 expression (CD70-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 4 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Moderate CD30 expression (CD30++); Low CD70 expression (CD70+)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Hodgkin lymphoma L-428 cells CVCL_1361
Experiment 5 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Clear cell renal cell carcinoma Caki-1 cells CVCL_0234
Experiment 6 Reporting the Activity Date of This ADC [68]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 1000 ng/mL Positive CD70 expression (CD70+++/++); Negative CD30 expression (CD30-)
Method Description
Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity,and induction of apoptosis of the ADC of the invention. Culturing the cells for a period from about 6 hours to about 5 days and measuring cell viability.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
EphA2-targeted mAb ADC B 23 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 24 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
4 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 24 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.03 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.5 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 19 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.4 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 21 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.4 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 17 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
25 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
4 pg/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 22 (DAR6) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
EphA2-targeted mAb ADC B 12 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.01 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
7 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
EphA2-targeted mAb ADC B 23 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 12 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.02 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.3 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 12 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 pg/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 20 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.02 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.5 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 19 (DAR4) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.02 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.5 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 20 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 17 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
0.2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
EphA2-targeted mAb ADC B 12 (DAR8) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the L540cy cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Hodgkin's disease L540cy cells Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
1 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the Karpas-299 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 3 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50)
2 ng/mL
Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MOLM-13 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 4 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the SU-DHL-4 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 5 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the MDA-MB-231 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 6 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the Ls174T cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Colon adenocarcinoma LS174T cells CVCL_1384
Experiment 7 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the BxPC3 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 8 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the A2058 cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Melanoma A2058 cells CVCL_1059
Experiment 9 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 1000 ng/mL Positive EPHA2 expression (EPHA2+++/++); Negative CD30 expression (CD30-)
Method Description
Potency of compounds and ADCs was evaluated using the 786-O cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Renal cell carcinoma 786-O cells CVCL_1051
Experiment 10 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells (Brentuximab vedotin resistance). Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells (Brentuximab vedotin resistant) CVCL_1170
Experiment 11 Reporting the Activity Date of This ADC [69]
Efficacy Data Half Maximal Effective Concentration (EC50) > 4 pg/mL Positive EPHA2 expression (EPHA2+++/++); Positive CD30 expression (CD30+++/++)
Method Description
Potency of compounds and ADCs was evaluated using the DEL cells. Cells were plated in a 96-well flat bottom tissue culture-treated clear polystyrene plate at ~100,000 cells per well in 200 uL with the indicated concentration of the compound or ADC.
In Vitro Model Anaplastic large cell lymphoma DEL cells CVCL_1170
Brentuximab-PNUEDAGly5 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [70]
Efficacy Data Half Maximal Effective Concentration (EC50)
4.8 ng/mL
High HER2 expression (HER2 +++)
Method Description
For this, cells were plated on 96 well plates in 100 ul DMEM/10% FCS at adensity of 104 cells per well and assays were performed.
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 2 Reporting the Activity Date of This ADC [70]
Efficacy Data Half Maximal Effective Concentration (EC50)
11 ng/mL
Low HER2 expression (HER2 +)
Method Description
For this, cells were plated on 96 well plates in 100 ul DMEM/10% FCS at adensity of 104 cells per well and assays were performed.
In Vitro Model Invasive breast carcinoma T-47D cells CVCL_0553
JP7623413B2 ExampleADC29 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC70)
0.028 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC28 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC69)
0.036 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 29%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC27 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC68)
0.04 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 28%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC26 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC67)
0.0098 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 27%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC25 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC66)
0.046 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 26%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC24 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC65)
0.043 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 25%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC23 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC64)
0.029 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 24%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC22 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC63)
0.029 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 23%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC21 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC62)
0.022 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 22%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC20 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC61)
0.008 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 21%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC19 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC60)
0.004 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 20%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC18 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC59)
. .
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 19%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC17 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC58)
. .
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 18%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC16 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC57)
0.029 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 17%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC15 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC56)
0.495 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 16%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC14 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC55)
0.05 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 15%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC13 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC54)
0.588 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 14%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC12 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC53)
0.034 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 13%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC11 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC52)
0.114 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 12%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC10 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC51)
0.027 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 11%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC19 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.004 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC20 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.008 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC26 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.0098 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC33 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.011 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC35 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.018 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.019 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC4 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.019 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC3 7.31 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.019 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC4 8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.019 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 6.6 nM
Method Description
The SK-BR-3 cells (ATCC), which are negative for CD30 antigen but positive for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
JP7623413B2 ExampleADC1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.02 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test). In addition, SK-BR-3
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.02 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC1 7.55 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.02 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
Experiment 2 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 6.6 nM
Method Description
The SK-BR-3 cells (ATCC), which are negative for CD30 antigen but positive for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
JP2025004232A ADC2 8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.02 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC38 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.021 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC21 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.022 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC40 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.022 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC10 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.027 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC29 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.028 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC16 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.029 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC22 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.029 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC23 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.029 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC37 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.03 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC6 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.034 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.034 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC6 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.034 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.034 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC12 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.034 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC5 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.036 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC5 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.036 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC28 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.036 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC27 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.04 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC39 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.042 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC24 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.043 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC7 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.046 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 10%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC7 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.046 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC25 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.046 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC14 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.05 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC34 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.061 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC36 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.098 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC11 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.114 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC15 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.495 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP2025004232A ADC13 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [72]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.588 nM
Method Description
The Karpas-299 cells (ECACC), which express CD30 antigen and are negative for HER2 antigen, were cultured to reach 2×106 cells/mL. 50 uL of each was added to 96-well cell culture microplates. 50 uL of CellTiter-Glo Luminescent Cell Viability Assay (Promega) was added to each well and mixed. The mixture was incubated in the dark for 20 minutes. The luminescence was measured using a microplate illuminometer, and the cell survival rates at each ADC concentration were calculated accordingly.The IC50 value can be calculated based on the value of cell survival rate.

   Click to Show/Hide
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC42 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.0006 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC31 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.0072 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC43 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.01 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC33 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.011 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC30 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.015 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC35 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.018 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC38 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.021 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC40 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.022 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC37 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.03 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC39 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.042 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC64 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.05 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC34 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.061 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC32 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.083 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC36 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.098 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
ExampleADC41 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
0.18 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
JP7623413B2 ExampleADC63 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [71]
Efficacy Data Half Maximal inhibitory Concentration (IC50)
1.98 nM
Positive CD30 expression (CD30+++/++)
Method Description
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
In Vitro Model ALK-positive anaplastic large cell lymphoma Karpas-299 cells CVCL_1324
References
Ref 1 Brentuximab Vedotin for Patients With Refractory Lymphomatoid Papulosis: An Analysis of Phase 2 Results. JAMA Dermatol. 2017 Dec 1;153(12):1302-1306.
Ref 2 Brentuximab Vedotin Plus AVD for First-Line Treatment of Early-Stage Unfavorable Hodgkin Lymphoma (BREACH): A Multicenter, Open-Label, Randomized, Phase II Trial. J Clin Oncol. 2023 Jan 10;41(2):327-335. doi: 10.1200/JCO.21.01281. Epub 2022 Jul 22.
Ref 3 The ECHELON-2 Trial: 5-year results of a randomized, phase III study of brentuximab vedotin with chemotherapy for CD30-positive peripheral T-cell lymphoma. Ann Oncol. 2022 Mar;33(3):288-298.
Ref 4 Five-year PFS from the AETHERA trial of brentuximab vedotin for Hodgkin lymphoma at high risk of progression or relapse. Blood. 2018 Dec 20;132(25):2639-2642. doi: 10.1182/blood-2018-07-861641. Epub 2018 Sep 28.
Ref 5 Pembrolizumab versus brentuximab vedotin in relapsed or refractory classical Hodgkin lymphoma (KEYNOTE-204): an interim analysis of a multicentre, randomised, open-label, phase 3 study. Lancet Oncol. 2021 Apr;22(4):512-524.
Ref 6 A phase 2 study of brentuximab vedotin in patients with CD30-positive advanced systemic mastocytosis. Blood Adv. 2019 Aug 13;3(15):2264-2271. doi: 10.1182/bloodadvances.2019000152.
Ref 7 A phase 2, open-label study of brentuximab vedotin in patients with CD30-expressing solid tumors. Invest New Drugs. 2019 Aug;37(4):738-747. doi: 10.1007/s10637-019-00768-6. Epub 2019 Apr 16.
Ref 8 Brentuximab vedotin in relapsed primary mediastinal large B-cell lymphoma: results from a phase 2 clinical trial. Blood. 2017 Apr 20;129(16):2328-2330.
Ref 9 Efficacy of Brentuximab Vedotin in Relapsed or Refractory High-CD30-Expressing Non-Hodgkin Lymphomas: Results of a Multicenter, Open-Labeled Phase II Trial. Cancer Res Treat. 2020 Apr;52(2):374-387.
Ref 10 Objective responses in relapsed T-cell lymphomas with single-agent brentuximab vedotin. Blood. 2014 May 15;123(20):3095-100.
Ref 11 A phase II study of brentuximab vedotin in patients with relapsed or refractory Epstein-Barr virus-positive and CD30-positive lymphomas. Haematologica. 2021 Aug 1;106(8):2277-2280.
Ref 12 Brentuximab vedotin in the treatment of elderly Hodgkin lymphoma patients at first relapse or with primary refractory disease: a phase II study of FIL ONLUS. Haematologica. 2020 Oct 1;105(10):e512.
Ref 13 Retreatment with brentuximab vedotin in patients with CD30-positive hematologic malignancies. J Hematol Oncol. 2014 Mar 19;7:24.
Ref 14 Durable remissions in a pivotal phase 2 study of brentuximab vedotin in relapsed or refractory Hodgkin lymphoma. Blood. 2015 Feb 19;125(8):1236-43.
Ref 15 Results of a pivotal phase II study of brentuximab vedotin for patients with relapsed or refractory Hodgkin's lymphoma. J Clin Oncol. 2012 Jun 20;30(18):2183-9.
Ref 16 Brentuximab vedotin (SGN-35) in patients with relapsed or refractory systemic anaplastic large-cell lymphoma: results of a phase II study. J Clin Oncol. 2012 Jun 20;30(18):2190-6.
Ref 17 Phase 2 study of frontline brentuximab vedotin monotherapy in Hodgkin lymphoma patients aged 60 years and older. Blood. 2015 Dec 24;126(26):2798-804.
Ref 18 Nivolumab and brentuximab vedotin with or without bendamustine for R/R Hodgkin lymphoma in children, adolescents, and young adults. Blood. 2023 Apr 27;141(17):2075-2084. doi: 10.1182/blood.2022017118.
Ref 19 Brentuximab vedotin plus doxorubicin and dacarbazine in?nonbulky limited-stage classical Hodgkin lymphoma. Blood Adv. 2023 Apr 11;7(7):1130-1136. doi: 10.1182/bloodadvances.2022008420.
Ref 20 Frontline brentuximab vedotin in combination with dacarbazine or bendamustine in patients aged 60 years with HL. Blood. 2017 Dec 28;130(26):2829-2837.
Ref 21 Brentuximab vedotin plus bendamustine in relapsed or refractory Hodgkin's lymphoma: an international, multicentre, single-arm, phase 1-2 trial. Lancet Oncol. 2018 Feb;19(2):257-266.
Ref 22 Brentuximab vedotin (SGN-35) for relapsed CD30-positive lymphomas. N Engl J Med. 2010 Nov 4;363(19):1812-21.
Ref 23 Nivolumab Combined With Brentuximab Vedotin for Relapsed/Refractory Primary Mediastinal Large B-Cell Lymphoma: Efficacy and Safety From the Phase II CheckMate 436 Study. J Clin Oncol. 2019 Nov 20;37(33):3081-3089.
Ref 24 Interim results of brentuximab vedotin in combination with nivolumab in patients with relapsed or refractory Hodgkin lymphoma. Blood. 2018 Mar 15;131(11):1183-1194.
Ref 25 Brentuximab vedotin in combination with nivolumab in relapsed or refractory Hodgkin lymphoma: 3-year study results. Blood. 2021 Aug 12;138(6):427-438.
Ref 26 Five-year outcomes for frontline brentuximab vedotin with CHP for CD30-expressing peripheral T-cell lymphomas. Blood. 2018 May 10;131(19):2120-2124. doi: 10.1182/blood-2017-12-821009. Epub 2018 Mar 5.
Ref 27 U.S. Food and Drug Administration approval summary: brentuximab vedotin for the treatment of relapsed Hodgkin lymphoma or relapsed systemic anaplastic large-cell lymphoma. Clin Cancer Res. 2012 Nov 1;18(21):5845-9.
Ref 28 A phase I weekly dosing study of brentuximab vedotin in patients with relapsed/refractory CD30-positive hematologic malignancies. Clin Cancer Res. 2012 Jan 1;18(1):248-55.
Ref 29 Phase 1/dose expansion trial of brentuximab vedotin andlenalidomide in relapsed or refractory diffuse large B-cell lymphoma. Blood. 2022 Mar 31;139(13):1999-2010.
Ref 30 Brentuximab vedotin with chemotherapy for stage III/IV classical Hodgkin lymphoma: 3-year update of the ECHELON-1 study. Blood. 2020 Mar 5;135(10):735-742.
Ref 31 Brentuximab vedotin with chemotherapy for stage III or IV classical Hodgkin lymphoma (ECHELON-1): 5-year update of an international, open-label, randomised, phase 3 trial. Lancet Haematol. 2021 Jun;8(6):e410-e421.
Ref 32 Brentuximab vedotin activity in diffuse large B-cell lymphoma with CD30 undetectable by visual assessment of conventional immunohistochemistry. Leuk Lymphoma. 2017 Jul;58(7):1607-1616.
Ref 33 Results of a Phase II Trial of Brentuximab Vedotin for CD30+ Cutaneous T-Cell Lymphoma and Lymphomatoid Papulosis. J Clin Oncol. 2015 Nov 10;33(32):3759-65.
Ref 34 Autologous stem-cell transplantation after second-line brentuximab vedotin in relapsed or refractory Hodgkin lymphoma. Ann Oncol. 2018 Mar 1;29(3):724-730.
Ref 35 Phase 1 multicenter trial of brentuximab vedotin for steroid-refractory acute graft-versus-host disease. Blood. 2017 Jun 15;129(24):3256-3261.
Ref 36 Tisagenlecleucel in Adult Relapsed or Refractory Diffuse Large B-Cell Lymphoma. N Engl J Med. 2019 Jan 3;380(1):45-56.
Ref 37 Brentuximab vedotin with gemcitabine for paediatric and young adult patients with relapsed or refractory Hodgkin's lymphoma (AHOD1221): a Children's Oncology Group, multicentre single-arm, phase 1-2 trial. Lancet Oncol. 2018 Sep;19(9):1229-1238.
Ref 38 Dose-dense brentuximab vedotin plus ifosfamide, carboplatin, and etoposide for second-line treatment of relapsed or refractory classical Hodgkin lymphoma: a single centre, phase 1/2 study. Lancet Haematol. 2021 Aug;8(8):e562-e571.
Ref 39 Brentuximab vedotin in combination with rituximab, cyclophosphamide, doxorubicin, and prednisone as frontline treatment for patients with CD30-positive B-cell lymphomas. Haematologica. 2021 Jun 1;106(6):1705-1713.
Ref 40 Brentuximab vedotin combined with ABVD or AVD for patients with newly diagnosed Hodgkin's lymphoma: a phase 1, open-label, dose-escalation study. Lancet Oncol. 2013 Dec;14(13):1348-56.
Ref 41 A phase I/II trial of brentuximab vedotin plus rituximab as frontline therapy for patients with immunosuppression-associated CD30+ and/or EBV+lymphomas. Leuk Lymphoma. 2021 Dec;62(14):3493-3500.
Ref 42 Randomized phase 3 ALCANZA study of brentuximab vedotin vs physician's choice in cutaneous T-cell lymphoma: final data. Blood Adv. 2021 Dec 14;5(23):5098-5106.
Ref 43 Brentuximab Vedotin with Chemotherapy for Stage III or IV Hodgkin's Lymphoma. N Engl J Med. 2018 Jan 25;378(4):331-344.
Ref 44 Brentuximab vedotin or physician's choice in CD30-positive cutaneous T-cell lymphoma (ALCANZA): an international, open-label, randomised, phase 3, multicentre trial. Lancet. 2017 Aug 5;390(10094):555-566.
Ref 45 Brentuximab Vedotin with Chemotherapy in Pediatric High-Risk Hodgkin's Lymphoma. N Engl J Med. 2022 Nov 3;387(18):1649-1660.
Ref 46 Overall Survival with Brentuximab Vedotin in Stage III or IV Hodgkin's Lymphoma. N Engl J Med. 2022 Jul 28;387(4):310-320.
Ref 47 Brentuximab vedotin plus nivolumab as first-line therapy in older or chemotherapy-ineligible patients with Hodgkin lymphoma (ACCRU): a multicentre, single-arm, phase 2 trial. Lancet Haematol. 2020 Nov;7(11):e808-e815. doi: 10.1016/S2352-3026(20)30275-1. Epub 2020 Oct 1.
Ref 48 Phase II trial of brentuximab vedotin in relapsed/refractory germ cell tumors. Invest New Drugs. 2021 Dec;39(6):1656-1663.
Ref 49 Brentuximab vedotin in combination with chemotherapy for pediatric patients with ALK+ ALCL: results of COG trial ANHL12P1. Blood. 2021 Jul 1;137(26):3595-3603.
Ref 50 Brentuximab vedotin plus nivolumab after autologous haematopoietic stem-cell transplantation for adult patients with high-risk classic Hodgkin lymphoma: a multicentre, phase 2 trial. Lancet Haematol. 2023 Jan;10(1):e14-e23.
Ref 51 Final results of brentuximab vedotin combined with ifosfamide-carboplatin-etoposide in first refractory/relapsed Hodgkin lymphoma: a lymphoma study association phase I/II study. Leuk Lymphoma. 2022 Dec;63(13):3063-3071.
Ref 52 Protease-activated drug development. Theranostics. 2012;2(2):156-78.
Ref 53 The novel PI3K- inhibitor TGR-1202 enhances Brentuximab Vedotin-induced Hodgkin lymphoma cell death via mitotic arrest. Leukemia. 2016 Dec;30(12):2402-2405.
Ref 54 Augmented efficacy of brentuximab vedotin combined with ruxolitinib and/or Navitoclax in a murine model of human Hodgkin's lymphoma. Proc Natl Acad Sci U S A. 2016 Feb 9;113(6):1624-9.
Ref 55 Combination of the anti-CD30-auristatin-E antibody-drug conjugate (SGN-35) with chemotherapy improves antitumour activity in Hodgkin lymphoma. Br J Haematol. 2008 Jul;142(1):69-73.
Ref 56 cAC10-vcMMAE, an anti-CD30-monomethyl auristatin E conjugate with potent and selective antitumor activity. Blood. 2003 Aug 15;102(4):1458-65.
Ref 57 https://tubulis.com/
Ref 58 Engineering a mevalonate pathway in Escherichia coli for production of terpenoids. Nat Biotechnol. 2003 Jul;21(7):796-802.
Ref 59 An antibody-drug conjugate that targets tissue factor exhibits potent therapeutic activity against a broad range of solid tumors. Cancer Res. 2014 Feb 15;74(4):1214-26.
Ref 60 Brentuximab vedotin exerts profound antiproliferative and pro-apoptotic efficacy in CD30-positive as well as cocultured CD30-negative germ cell tumour cell lines. J Cell Mol Med. 2018 Jan;22(1):568-575.
Ref 61 Intracellular activation of SGN-35, a potent anti-CD30 antibody-drug conjugate. Clin Cancer Res. 2010 Feb 1;16(3):888-97.
Ref 62 A Study of F0002-ADC in Chinese Patients With Refractory or Recurrent CD30+ Hematologic Malignancies.
Ref 63 A Safety Study of SGN-35T in Adults With Advanced Cancers
Ref 64 Development of Novel Antibody-Camptothecin Conjugates. Mol Cancer Ther. 2021 Feb;20(2):329-339.
Ref 65 Beta-glucuronide-linker drug conjugates; 2007-10-25.
Ref 66 Highly Potent, Anthracycline-based Antibody-Drug Conjugates Generated by Enzymatic, Site-specific Conjugation. Mol Cancer Ther. 2017 May;16(5):879-892.
Ref 67 Incorporation of Hydrophilic Macrocycles Into Drug-Linker Reagents Produces Antibody-Drug Conjugates With Enhanced in vivo Performance. Front Pharmacol. 2022 Jun 17;13:764540. doi: 10.3389/fphar.2022.764540. eCollection 2022.
Ref 68 Methylene carbamate linkers for use with targeted-drug conjugates; 2015-06-25.
Ref 69 Immunomodulatory antibody-drug conjugates; 2022-07-21.
Ref 70 Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof; 2017-10-19.
Ref 71 Antibody-drug complexes containing hemiasterlin derivatives
Ref 72 Antibody-drug complexes containing hemiasterlin derivatives