Antigen ID	TAR0AIJKM
Antigen Name	Hepatocyte growth factor receptor (MET)
Gene Name	MET
Gene ID	4233
Synonym	HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met
Sequence	MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD TRPASFWETS     Click to Show/Hide
Family	Tyr protein family
Function	Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. The RAS-ERK activation is associated with the morphogenetic effects while PI3K/AKT coordinates prosurvival effects. During embryonic development, MET signaling plays a role in gastrulation, development and migration of neuronal precursors, angiogenesis and kidney formation. During skeletal muscle development, it is crucial for the migration of muscle progenitor cells and for the proliferation of secondary myoblasts. In adults, participates in wound healing as well as organ regeneration and tissue remodeling. Promotes also differentiation and proliferation of hematopoietic cells. May regulate cortical bone osteogenesis.     Click to Show/Hide
Uniprot Entry	MET_HUMAN
HGNC ID	HGNC:7029
KEGG ID	hsa:4233

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	AAJ8D6-Mc-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]
ADC Info	AAJ8D6-D07-Val-Cit-PAB-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]
ADC Info	AAJ8D6-PY-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	PY-VC-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	lgG1-Mc-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-c-Met IgG-OXA	Oxaliplatin	Human Deoxyribonucleic acid (hDNA)	Dipeptide-p-amidobenzyl alcohol linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN106188293A ADC-1	CN106188293A_ADC-136584232	Undisclosed	CN106188293A_ADC-1LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-2	CN106188293A_ADC-236584232	Undisclosed	CN106188293A_ADC-2LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-3	CN106188293A_ADC-336584232	Undisclosed	CN106188293A_ADC-3LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-4	CN106188293A_ADC-436584232	Undisclosed	CN106188293A_ADC-4LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-9	CN106188293A_ADC-936584232	Undisclosed	CN106188293A_ADC-9LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-12	CN106188293A_ADC-1236584232	Undisclosed	CN106188293A_ADC-12LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN106188293A ADC-13	CN106188293A_ADC-1336584232	Undisclosed	CN106188293A_ADC-13LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-14	CN106188293A_ADC-1436584232	Undisclosed	CN106188293A_ADC-14LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-15	CN106188293A_ADC-1536584232	Undisclosed	CN106188293A_ADC-15LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN106188293A ADC-5	CN106188293A_ADC-536584232	Undisclosed	CN106188293A_ADC-5LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-6	CN106188293A_ADC-636584232	Undisclosed	CN106188293A_ADC-6LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-7	CN106188293A_ADC-736584232	Undisclosed	CN106188293A_ADC-7LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-8	CN106188293A_ADC-836584232	Undisclosed	CN106188293A_ADC-8LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-10	CN106188293A_ADC-1036584232	Undisclosed	CN106188293A_ADC-10LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]
ADC Info	CN106188293A ADC-11	CN106188293A_ADC-1136584232	Undisclosed	CN106188293A_ADC-11LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CIRCR201-dPBD	Glucuronide-dPBD	Human Deoxyribonucleic acid (hDNA)	Iso-PEG5-beta-glucuronide	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HD12-SG3249	PBD dimer SG3249	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[5]
ADC Info	HD12-SG3259	PBD dimer SG3259	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[5]
ADC Info	HD12-SG3315	PBD dimer SG3315	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[5]
ADC Info	HD12-SG3246	PBD dimer SG3246	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[5]
ADC Info	HD12-SG3227	PBD dimer SG3227	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LY3343544	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[6]
ADC Info	Emibetuzumab-ADC-24-1	Emibetuzumab-ADC-24-1 payload	Undisclosed	Emibetuzumab-ADC-24-1 linker	[7]
ADC Info	Emibetuzumab-ADC-24-2	Emibetuzumab-ADC-24-2 payload	Undisclosed	Emibetuzumab-ADC-24-2 linker	[7]
ADC Info	Emibetuzumab-ADC-24-3	Emibetuzumab-ADC-24-3 payload	Undisclosed	Emibetuzumab-ADC-24-3 linker	[7]
ADC Info	Emibetuzumab-ADC-24-4	Emibetuzumab-ADC-24-4 payload	Undisclosed	Emibetuzumab-ADC-24-4 linker	[7]
ADC Info	Emibetuzumab-ADC-24-5	Emibetuzumab-ADC-24-5 payload	Undisclosed	Emibetuzumab-ADC-24-5 linker	[7]
ADC Info	Emibetuzumab-ADC-24-6	Emibetuzumab-ADC-24-6 payload	Undisclosed	Emibetuzumab-ADC-24-6 linker	[7]
ADC Info	Emibetuzumab-ADC-24-7	Emibetuzumab-ADC-24-7 payload	Undisclosed	Emibetuzumab-ADC-24-7 linker	[7]
ADC Info	Emibetuzumab-ADC-24-8	Emibetuzumab-ADC-24-8 payload	Undisclosed	Emibetuzumab-ADC-24-8 linker	[7]
ADC Info	Emibetuzumab-ADC-24-9	Emibetuzumab-ADC-24-9 payload	Undisclosed	Emibetuzumab-ADC-24-9 linker	[7]
ADC Info	Emibetuzumab-ADC-24-10	Emibetuzumab-ADC-24-10 payload	Undisclosed	Emibetuzumab-ADC-24-10 linker	[7]
ADC Info	Emibetuzumab-ADC-24-11	Emibetuzumab-ADC-24-11 payload	Undisclosed	Emibetuzumab-ADC-24-11 linker	[7]
ADC Info	Emibetuzumab-ADC-24-12	Emibetuzumab-ADC-24-12 payload	Undisclosed	Emibetuzumab-ADC-24-12 linker	[7]
ADC Info	Emibetuzumab-ADC-24-13	Emibetuzumab-ADC-24-13 payload	Undisclosed	Emibetuzumab-ADC-24-13 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	PCM-MET01-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	REGN5093-M114	Maytansine derivative M24	Microtubule (MT)	Undisclosed	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	SHR-A1403	SHR152852	Microtubule (MT)	Uncleavable linker	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	C-met monoclonal antibody-drug conjugate	Mertansine DM1	Microtubule (MT)	Undisclosed	[11]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Telisotuzumab vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[12]
ADC Info	ABT-700 (S238C)-PBD	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Mc-Val-Ala	[13]
ADC Info	ABT-700-Mc-Val-Cit-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	TR1801-ADC	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[14]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RC-108	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[15]
ADC Info	BYON-3521	Undisclosed	Undisclosed	Undisclosed	[16]
ADC Info	MYTX-011	Undisclosed	Undisclosed	Undisclosed	[17]
ADC Info	Hu-cMet 27Gv1.3 Hinge-L-DM21	Undisclosed	Undisclosed	Undisclosed	[18]
ADC Info	SAB-Y14	Undisclosed	Undisclosed	Undisclosed	[19]
ADC Info	C-MET 0174	Undisclosed	Undisclosed	Undisclosed	[20]
ADC Info	APS-3010	Undisclosed	Undisclosed	Undisclosed	[21]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113362283; Fold-change: 0.10288011; Z-score: 0.256367938
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.899624056; Fold-change: -0.007779226; Z-score: -0.034680677
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.55E-06; Fold-change: 0.918615351; Z-score: 4.677161223
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.12E-07; Fold-change: -0.635173864; Z-score: -3.028638219
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.31E-30; Fold-change: -0.501100573; Z-score: -0.831750032
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009748382; Fold-change: 0.056135988; Z-score: 0.398800292
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.344472079; Fold-change: 0.002445927; Z-score: 0.021323454
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.933434753; Fold-change: 0.036244506; Z-score: 0.114068213
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.219206498; Fold-change: 0.057631057; Z-score: 0.601955218
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.609609367; Fold-change: 0.381114081; Z-score: 0.858482891
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.356664397; Fold-change: 0.148555621; Z-score: 0.564028931
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.14E-06; Fold-change: 0.732907803; Z-score: 1.581303825
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.33E-23; Fold-change: 0.57042165; Z-score: 1.136392538
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.56E-40; Fold-change: 1.464794268; Z-score: 2.180978753
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003971371; Fold-change: 0.609950105; Z-score: 0.861523878
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.88E-05; Fold-change: 0.195543016; Z-score: 0.679899207
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.923839495; Fold-change: -0.079681317; Z-score: -0.083542481
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.28E-18; Fold-change: 0.693378461; Z-score: 1.054179996
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.341838868; Fold-change: 0.388163117; Z-score: 0.412320017
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024818605; Fold-change: -0.514455997; Z-score: -0.688491461
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.862496199; Fold-change: -0.089686009; Z-score: -0.092419918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.081056202; Fold-change: 1.307299049; Z-score: 0.862024478
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.33E-20; Fold-change: -0.310434713; Z-score: -0.504249002
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.098218549; Fold-change: -0.372023621; Z-score: -1.324581457
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.27E-29; Fold-change: -0.621911521; Z-score: -0.97108526
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.42E-05; Fold-change: -0.541473624; Z-score: -1.030628746
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015939222; Fold-change: 0.553795574; Z-score: 0.795045431
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.715604341; Fold-change: 0.097856914; Z-score: 0.131548622
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.777563562; Fold-change: -0.040191957; Z-score: -0.153009318
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030424097; Fold-change: 0.06420923; Z-score: 0.090845207
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.661818776; Fold-change: -0.177504548; Z-score: -0.555506502
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.47E-07; Fold-change: -1.669097248; Z-score: -1.881925679
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.316700642; Fold-change: -0.050963114; Z-score: -0.317859629
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.59E-05; Fold-change: 1.575752837; Z-score: 9.929458904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.71E-34; Fold-change: 1.521614722; Z-score: 2.667907025
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.39E-10; Fold-change: 1.274420242; Z-score: 1.893946811
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.000683507; Fold-change: 0.016335317; Z-score: 0.088889895
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.61609304; Fold-change: 0.314; Z-score: 0.367006956
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.60E-05; Fold-change: -0.756462256; Z-score: -2.025673726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.62E-06; Fold-change: -1.018634162; Z-score: -2.605419737
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.154794958; Fold-change: 0.119041478; Z-score: 0.795438808
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.134597057; Fold-change: -0.101698164; Z-score: -0.243656529
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005531972; Fold-change: -0.391423184; Z-score: -2.86394114
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00067453; Fold-change: -0.120649735; Z-score: -0.70247158
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.380616787; Fold-change: 0.079291951; Z-score: 0.198698462
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.115244022; Fold-change: -0.122269327; Z-score: -0.299701486
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.694409878; Fold-change: -0.150703461; Z-score: -0.478805569
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.41873538; Fold-change: -1.197394385; Z-score: -0.919261436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003758385; Fold-change: 0.075077287; Z-score: 0.680571337
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.689340813; Fold-change: 0.046616167; Z-score: 0.241532297
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.058583575; Fold-change: -0.125845019; Z-score: -0.564866076
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.236006311; Fold-change: -0.986363295; Z-score: -1.430304338
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.208231837; Fold-change: 0.100982364; Z-score: 0.352763505
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.892425988; Fold-change: -0.036079093; Z-score: -0.230914551
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.32E-05; Fold-change: 0.041028825; Z-score: 0.224116193
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.715393705; Fold-change: 0.013270958; Z-score: 0.094743196
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.880307221; Fold-change: 0.031848665; Z-score: 0.179110268
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021259985; Fold-change: 0.226222463; Z-score: 0.64214181
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030877456; Fold-change: -0.161510571; Z-score: -1.977617785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.719062841; Fold-change: 0.169721969; Z-score: 0.497206752
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.561338194; Fold-change: 0.000981123; Z-score: 0.010244499
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.646855684; Fold-change: 0.127859819; Z-score: 0.423366599
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048984164; Fold-change: 0.048537357; Z-score: 1.019096734
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.292755252; Fold-change: -0.149187025; Z-score: -0.482805815
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.659145721; Fold-change: -0.296259891; Z-score: -1.092607159
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.235596475; Fold-change: 0.314413047; Z-score: 1.181958123
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257337983; Fold-change: 0.045979111; Z-score: 0.076743364
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.42E-07; Fold-change: -0.573427327; Z-score: -1.081542857
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000118924; Fold-change: -0.119342085; Z-score: -0.111073351
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.085512103; Fold-change: 0.063139673; Z-score: 0.262965118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.76856135; Fold-change: -0.014880327; Z-score: -0.072631257
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.111213329; Fold-change: 0.110586257; Z-score: 0.284636617
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.395568175; Fold-change: -0.093180281; Z-score: -1.262606746
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.424489758; Fold-change: 0.196190832; Z-score: 0.75340056
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.40061042; Fold-change: 0.026139043; Z-score: 0.106500306
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.07272325; Fold-change: 0.104721807; Z-score: 0.389295373
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.32008292; Fold-change: -0.016642974; Z-score: -0.065463972
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.51E-25; Fold-change: -0.511608187; Z-score: -1.056777327
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.52E-55; Fold-change: 1.92183309; Z-score: 7.207087516
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.554762221; Fold-change: -0.105794413; Z-score: -0.677485486
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.385929288; Fold-change: -0.040363012; Z-score: -0.166033066
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.475429528; Fold-change: -0.098766895; Z-score: -0.274461933
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.370797249; Fold-change: 0.118125144; Z-score: 0.355263447
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004107359; Fold-change: 0.07075017; Z-score: 0.85206146
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.278680838; Fold-change: 0.0501455; Z-score: 0.270019099
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.41E-06; Fold-change: 1.217529852; Z-score: 4.633463186
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.167914213; Fold-change: 0.120426729; Z-score: 1.296820113
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.368328846; Fold-change: -0.495586357; Z-score: -0.737499692
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.271100147; Fold-change: 0.22297765; Z-score: 0.495592722
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009232582; Fold-change: -0.459921401; Z-score: -1.365282735
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.298870551; Fold-change: -0.095175576; Z-score: -0.405908407
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.68965086; Fold-change: 0.006292021; Z-score: 0.019320424
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.402563216; Fold-change: 0.029433549; Z-score: 0.124612656
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.313734116; Fold-change: 0.038182995; Z-score: 0.247061911
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.65E-06; Fold-change: 0.386657523; Z-score: 1.030877618
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.517367753; Fold-change: 0.132406771; Z-score: 0.323764213
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.091147502; Fold-change: -0.408649046; Z-score: -1.909602421
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000492139; Fold-change: 1.385523096; Z-score: 3.147098868
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.51E-06; Fold-change: 0.830662068; Z-score: 4.278279424
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.495862942; Fold-change: -0.367969819; Z-score: -0.409952995
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.21E-45; Fold-change: 1.668097812; Z-score: 1.97421435
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02880893; Fold-change: 0.505490089; Z-score: 0.96696137
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.798862873; Fold-change: 0.181768757; Z-score: 0.284895101
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031593816; Fold-change: -0.089240886; Z-score: -0.549200717
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.196051613; Fold-change: -0.046078787; Z-score: -2.066450378
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.100305425; Fold-change: -0.660472208; Z-score: -1.237243288
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.32205302; Fold-change: 0.201414754; Z-score: 0.70940632
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.385458491; Fold-change: 0.085117658; Z-score: 0.429220768
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002157268; Fold-change: 0.096328754; Z-score: 0.769338841
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.093528338; Fold-change: 0.068898025; Z-score: 0.360561363
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.733294484; Fold-change: -0.05471058; Z-score: -0.239248125
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.230600313; Fold-change: -0.103348971; Z-score: -0.544630443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.134346705; Fold-change: 0.071683228; Z-score: 0.484602609
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.27926816; Fold-change: 0.007764694; Z-score: 0.076197788
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.661761377; Fold-change: 0.165914955; Z-score: 0.296828443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.098352012; Fold-change: 0.069436918; Z-score: 0.682973867
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.553237622; Fold-change: -0.053335537; Z-score: -0.360130669
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.45770282; Fold-change: -0.150555468; Z-score: -1.04991008
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.898477365; Fold-change: 0.04803612; Z-score: 0.356570299
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.238867175; Fold-change: 0.092397027; Z-score: 0.707771334
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02844717; Fold-change: 0.056721126; Z-score: 0.40020658
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.614778749; Fold-change: -0.015913062; Z-score: -0.04439037
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.619135853; Fold-change: -0.005325456; Z-score: -0.029289553
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001082598; Fold-change: -0.244065864; Z-score: -0.399707674
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.939885533; Fold-change: 0.022516796; Z-score: 0.133931478
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006899351; Fold-change: 0.518291952; Z-score: 3.578640551
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.577077697; Fold-change: 0.071537796; Z-score: 0.381754374
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.212351037; Fold-change: 0.124207231; Z-score: 0.346886356
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.99537877; Fold-change: -0.072763304; Z-score: -0.108206062
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Anti-c-met antibody-drug conjugate and applications thereof; 2022-03-10.
Ref 2	High-Affinity Human Anti-c-Met IgG Conjugated to Oxaliplatin as Targeted Chemotherapy for Hepatocellular Carcinoma. Front Oncol. 2019 Aug 2;9:717. doi: 10.3389/fonc.2019.00717. eCollection 2019.
Ref 3	Anti-C-met antibodies and anti-C-met antibodies-cytotoxic drug conjugate and medical usage thereof.
Ref 4	cIRCR201-dPBD, a Novel Pyrrolobenzodiazepine Dimer-Containing Site-Specific Antibody-Drug Conjugate Targeting c-Met Overexpression Tumors. ACS Omega. 2020 Sep 29;5(40):25798-25809. doi: 10.1021/acsomega.0c03102.
Ref 5	TR1801-ADC: a highly potent cMet antibody-drug conjugate with high activity in patient-derived xenograft models of solid tumors. Mol Oncol. 2020 Jan;14(1):54-68. doi: 10.1002/1878-0261.12600. Epub 2019 Dec 3.
Ref 6	A novel molecule with profound tumor killing activity. Cancer Res (2019) 79 (13_Supplement): 353.
Ref 7	Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof; 2020-04-02.
Ref 8	MET and RON receptor tyrosine kinases in colorectal adenocarcinoma: molecular features as drug targets and antibody-drug conjugates for therapy. J Exp Clin Cancer Res. 2020 Sep 22;39(1):198. doi: 10.1186/s13046-020-01711-x.
Ref 9	A phase 1/2 study of REGN5093-M114, a METxMET antibody-drug conjugate, in patients with mesenchymal epithelial transition factor (MET)-overexpressing NSCLC. Journal of Clinical Oncology 2022 40:16_suppl, TPS8593-TPS8593.
Ref 10	SHR-A1403, a novel c-Met antibody-drug conjugate, exerts encouraging anti-tumor activity in c-Met-overexpressing models. Acta Pharmacol Sin. 2019 Jul;40(7):971-979.
Ref 11	Introduction to basic information on ADC drug C-met monoclonal antibody-drug conjugate
Ref 12	Phase Ib Study of Telisotuzumab Vedotin in Combination With Erlotinib in Patients With c-Met Protein-Expressing Non-Small-Cell Lung Cancer. J Clin Oncol. 2023 Feb 10;41(5):1105-1115.
Ref 13	ANTI-cMet antibody drug conjugates and methods for their use; 2017-11-23.
Ref 14	TR1801-ADC: a highly potent cMet antibody-drug conjugate with high activity in patient-derived xenograft models of solid tumors. Mol Oncol. 2020 Jan;14(1):54-68.
Ref 15	A Study of RC108-ADC in subjects with advanced digestive system malignant tumor.
Ref 16	Preclinical Profile of BYON3521 Predicts an Effective and Safe MET Antibody-Drug Conjugate. Mol Cancer Ther. 2023 Jun 1;22(6):765-777. doi: 10.1158/1535-7163.MCT-22-0596.
Ref 17	MYTX-011: A novel cMET-targeting antibody drug conjugate (ADC) engineered to increase on-target uptake in and efficacy against cMET expressing tumors. Cancer Res (2023) 83 (7_Supplement): 5000.
Ref 18	Preclinical evaluation of a new, non-agonist ADC targeting MET-amplified tumors with a peptide-linked maytansinoid. Cancer Res (2019) 79 (13_Supplement): 4817.
Ref 19	Syntab therapeutics biotechnology company product pipeline
Ref 20	c-Met Antibody Drug Conjugate.
Ref 21	Introduction to basic information on ADC drug APS-3010.