General Information of This Antigen
Antigen ID
TAR0AIJKM
Antigen Name
Hepatocyte growth factor receptor (MET)
Gene Name
MET
Gene ID
4233
Synonym
HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met
Sequence
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS

    Click to Show/Hide
Family
Tyr protein family
Function
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. The RAS-ERK activation is associated with the morphogenetic effects while PI3K/AKT coordinates prosurvival effects. During embryonic development, MET signaling plays a role in gastrulation, development and migration of neuronal precursors, angiogenesis and kidney formation. During skeletal muscle development, it is crucial for the migration of muscle progenitor cells and for the proliferation of secondary myoblasts. In adults, participates in wound healing as well as organ regeneration and tissue remodeling. Promotes also differentiation and proliferation of hematopoietic cells. May regulate cortical bone osteogenesis.

    Click to Show/Hide
Uniprot Entry
MET_HUMAN
HGNC ID
HGNC:7029
KEGG ID
hsa:4233
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
A humanised anti-c-MET IgG2 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
SHR-A1403
SHR152852
Microtubule (MT)
L2-MC
[1]
A humanized c-MET-directed IgG2 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
SHR-1826
9106-IM-2
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly
ADC Info ADC Name Payload Target Linker Ref
AAJ8D6-D07-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
AAJ8D6-Mc-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
AAJ8D6-PY-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
PY-VC-PABC
[2]
Anti-MET lgG1
ADC Info ADC Name Payload Target Linker Ref
lgG1-Mc-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
Anti-MET mAb
ADC Info ADC Name Payload Target Linker Ref
Anti-c-Met IgG-OXA
Oxaliplatin
Human Deoxyribonucleic acid (hDNA)
Dipeptide-p-amidobenzyl alcohol linker
[3]
Anti-MET mAb Ab-10
ADC Info ADC Name Payload Target Linker Ref
CN106188293A ADC-1
CN106188293A_ADC-136584232
Undisclosed
CN106188293A_ADC-1LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-12
CN106188293A_ADC-1236584232
Undisclosed
CN106188293A_ADC-12LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-2
CN106188293A_ADC-236584232
Undisclosed
CN106188293A_ADC-2LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-3
CN106188293A_ADC-336584232
Undisclosed
CN106188293A_ADC-3LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-4
CN106188293A_ADC-436584232
Undisclosed
CN106188293A_ADC-4LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-9
CN106188293A_ADC-936584232
Undisclosed
CN106188293A_ADC-9LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
Anti-MET mAb Ab-11
ADC Info ADC Name Payload Target Linker Ref
CN106188293A ADC-13
CN106188293A_ADC-1336584232
Undisclosed
CN106188293A_ADC-13LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-14
CN106188293A_ADC-1436584232
Undisclosed
CN106188293A_ADC-14LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-15
CN106188293A_ADC-1536584232
Undisclosed
CN106188293A_ADC-15LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
Anti-MET mAb Ab-9
ADC Info ADC Name Payload Target Linker Ref
CN106188293A ADC-10
CN106188293A_ADC-1036584232
Undisclosed
CN106188293A_ADC-10LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-11
CN106188293A_ADC-1136584232
Undisclosed
CN106188293A_ADC-11LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-5
CN106188293A_ADC-536584232
Undisclosed
CN106188293A_ADC-5LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-6
CN106188293A_ADC-636584232
Undisclosed
CN106188293A_ADC-6LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-7
CN106188293A_ADC-736584232
Undisclosed
CN106188293A_ADC-7LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
CN106188293A ADC-8
CN106188293A_ADC-836584232
Undisclosed
CN106188293A_ADC-8LacNAc-based glycosite-specific conjudate through reduced inter-chain cysteines
[4]
Anti-MET mAb cIRCR201
ADC Info ADC Name Payload Target Linker Ref
CIRCR201-dPBD
Glucuronide-dPBD
Human Deoxyribonucleic acid (hDNA)
Iso-PEG5-beta-glucuronide
[5]
Anti-MET mAb hD12
ADC Info ADC Name Payload Target Linker Ref
HD12-SG3227
PBD dimer SG3227
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[6]
HD12-SG3246
PBD dimer SG3246
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[6]
HD12-SG3249
PBD dimer SG3249
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[6]
HD12-SG3259
PBD dimer SG3259
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[6]
HD12-SG3315
PBD dimer SG3315
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[6]
Emibetuzumab
ADC Info ADC Name Payload Target Linker Ref
Emibetuzumab-ADC-24-1
Emibetuzumab-ADC-24-1 payload
Undisclosed
Emibetuzumab-ADC-24-1 linker
[7]
Emibetuzumab-ADC-24-10
Emibetuzumab-ADC-24-10 payload
Undisclosed
Emibetuzumab-ADC-24-10 linker
[7]
Emibetuzumab-ADC-24-11
Emibetuzumab-ADC-24-11 payload
Undisclosed
Emibetuzumab-ADC-24-11 linker
[7]
Emibetuzumab-ADC-24-12
Emibetuzumab-ADC-24-12 payload
Undisclosed
Emibetuzumab-ADC-24-12 linker
[7]
Emibetuzumab-ADC-24-13
Emibetuzumab-ADC-24-13 payload
Undisclosed
Emibetuzumab-ADC-24-13 linker
[7]
Emibetuzumab-ADC-24-2
Emibetuzumab-ADC-24-2 payload
Undisclosed
Emibetuzumab-ADC-24-2 linker
[7]
Emibetuzumab-ADC-24-3
Emibetuzumab-ADC-24-3 payload
Undisclosed
Emibetuzumab-ADC-24-3 linker
[7]
Emibetuzumab-ADC-24-4
Emibetuzumab-ADC-24-4 payload
Undisclosed
Emibetuzumab-ADC-24-4 linker
[7]
Emibetuzumab-ADC-24-5
Emibetuzumab-ADC-24-5 payload
Undisclosed
Emibetuzumab-ADC-24-5 linker
[7]
Emibetuzumab-ADC-24-6
Emibetuzumab-ADC-24-6 payload
Undisclosed
Emibetuzumab-ADC-24-6 linker
[7]
Emibetuzumab-ADC-24-7
Emibetuzumab-ADC-24-7 payload
Undisclosed
Emibetuzumab-ADC-24-7 linker
[7]
Emibetuzumab-ADC-24-8
Emibetuzumab-ADC-24-8 payload
Undisclosed
Emibetuzumab-ADC-24-8 linker
[7]
Emibetuzumab-ADC-24-9
Emibetuzumab-ADC-24-9 payload
Undisclosed
Emibetuzumab-ADC-24-9 linker
[7]
LY3343544
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[8]
ADC Info ADC Name Payload Target Linker Ref
TR1801-ADC
SG3199
Human Deoxyribonucleic acid (hDNA)
Mal-PEG8-Val-Ala-PABC
[9]
PCM-MET01
ADC Info ADC Name Payload Target Linker Ref
PCM-MET01-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[10]
pH-dependent antic-MET antibody
ADC Info ADC Name Payload Target Linker Ref
MYTX-011
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[11]
ADC Info ADC Name Payload Target Linker Ref
REGN5093-M114
Maytansine derivative M24
Microtubule (MT)
Valeramide-Val-Cit-PABC
[12]
STI-D0606
ADC Info ADC Name Payload Target Linker Ref
C-met monoclonal antibody-drug conjugate
Mertansine DM1
Microtubule (MT)
Undisclosed
[13]
Telisotuzumab
ADC Info ADC Name Payload Target Linker Ref
Telisotuzumab vedotin
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[14]
ABBV-400
DNA topoisomerase-I inhibitor
DNA topoisomerase 1 (TOP1)
Valine-alanine linker
ABT-700 (S238C)-PBD
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Mc-Val-Ala
[15]
ABT-700-Mc-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
RC-108
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[16]
BYON-3521
seco-DUBA
Human Deoxyribonucleic acid (hDNA)
Mc-Val-Cit-PABC
[17]
YL-211
YL0010014
DNA topoisomerase 1 (TOP1)
Tumor microenviroment activable tripeptide linker
APS-3010
Undisclosed
Undisclosed
Undisclosed
[18]
C-MET 0174
Undisclosed
Undisclosed
Undisclosed
[19]
Hu-cMet 27Gv1.3 Hinge-L-DM21
Undisclosed
Undisclosed
Undisclosed
[20]
SAB-Y14
Undisclosed
Undisclosed
Undisclosed
[21]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113362283; Fold-change: 0.10288011; Z-score: 0.256367938
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.899624056; Fold-change: -0.007779226; Z-score: -0.034680677
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.55E-06; Fold-change: 0.918615351; Z-score: 4.677161223
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.12E-07; Fold-change: -0.635173864; Z-score: -3.028638219
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.31E-30; Fold-change: -0.501100573; Z-score: -0.831750032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009748382; Fold-change: 0.056135988; Z-score: 0.398800292
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.344472079; Fold-change: 0.002445927; Z-score: 0.021323454
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.933434753; Fold-change: 0.036244506; Z-score: 0.114068213
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.219206498; Fold-change: 0.057631057; Z-score: 0.601955218
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.609609367; Fold-change: 0.381114081; Z-score: 0.858482891
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.356664397; Fold-change: 0.148555621; Z-score: 0.564028931
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.14E-06; Fold-change: 0.732907803; Z-score: 1.581303825
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.33E-23; Fold-change: 0.57042165; Z-score: 1.136392538
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.56E-40; Fold-change: 1.464794268; Z-score: 2.180978753
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003971371; Fold-change: 0.609950105; Z-score: 0.861523878
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.88E-05; Fold-change: 0.195543016; Z-score: 0.679899207
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.923839495; Fold-change: -0.079681317; Z-score: -0.083542481
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.28E-18; Fold-change: 0.693378461; Z-score: 1.054179996
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.341838868; Fold-change: 0.388163117; Z-score: 0.412320017
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.024818605; Fold-change: -0.514455997; Z-score: -0.688491461
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.862496199; Fold-change: -0.089686009; Z-score: -0.092419918
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.081056202; Fold-change: 1.307299049; Z-score: 0.862024478
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.33E-20; Fold-change: -0.310434713; Z-score: -0.504249002
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.098218549; Fold-change: -0.372023621; Z-score: -1.324581457
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.27E-29; Fold-change: -0.621911521; Z-score: -0.97108526
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.42E-05; Fold-change: -0.541473624; Z-score: -1.030628746
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015939222; Fold-change: 0.553795574; Z-score: 0.795045431
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.715604341; Fold-change: 0.097856914; Z-score: 0.131548622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.777563562; Fold-change: -0.040191957; Z-score: -0.153009318
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030424097; Fold-change: 0.06420923; Z-score: 0.090845207
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.661818776; Fold-change: -0.177504548; Z-score: -0.555506502
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.47E-07; Fold-change: -1.669097248; Z-score: -1.881925679
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.316700642; Fold-change: -0.050963114; Z-score: -0.317859629
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.59E-05; Fold-change: 1.575752837; Z-score: 9.929458904
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.71E-34; Fold-change: 1.521614722; Z-score: 2.667907025
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.39E-10; Fold-change: 1.274420242; Z-score: 1.893946811
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.000683507; Fold-change: 0.016335317; Z-score: 0.088889895
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.61609304; Fold-change: 0.314; Z-score: 0.367006956
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.60E-05; Fold-change: -0.756462256; Z-score: -2.025673726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.62E-06; Fold-change: -1.018634162; Z-score: -2.605419737
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.154794958; Fold-change: 0.119041478; Z-score: 0.795438808
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.134597057; Fold-change: -0.101698164; Z-score: -0.243656529
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005531972; Fold-change: -0.391423184; Z-score: -2.86394114
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00067453; Fold-change: -0.120649735; Z-score: -0.70247158
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.380616787; Fold-change: 0.079291951; Z-score: 0.198698462
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.115244022; Fold-change: -0.122269327; Z-score: -0.299701486
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.694409878; Fold-change: -0.150703461; Z-score: -0.478805569
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.41873538; Fold-change: -1.197394385; Z-score: -0.919261436
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003758385; Fold-change: 0.075077287; Z-score: 0.680571337
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.689340813; Fold-change: 0.046616167; Z-score: 0.241532297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058583575; Fold-change: -0.125845019; Z-score: -0.564866076
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.236006311; Fold-change: -0.986363295; Z-score: -1.430304338
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.208231837; Fold-change: 0.100982364; Z-score: 0.352763505
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.892425988; Fold-change: -0.036079093; Z-score: -0.230914551
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.32E-05; Fold-change: 0.041028825; Z-score: 0.224116193
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.715393705; Fold-change: 0.013270958; Z-score: 0.094743196
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.880307221; Fold-change: 0.031848665; Z-score: 0.179110268
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021259985; Fold-change: 0.226222463; Z-score: 0.64214181
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030877456; Fold-change: -0.161510571; Z-score: -1.977617785
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.719062841; Fold-change: 0.169721969; Z-score: 0.497206752
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.561338194; Fold-change: 0.000981123; Z-score: 0.010244499
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.646855684; Fold-change: 0.127859819; Z-score: 0.423366599
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.048984164; Fold-change: 0.048537357; Z-score: 1.019096734
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.292755252; Fold-change: -0.149187025; Z-score: -0.482805815
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.659145721; Fold-change: -0.296259891; Z-score: -1.092607159
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.235596475; Fold-change: 0.314413047; Z-score: 1.181958123
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.257337983; Fold-change: 0.045979111; Z-score: 0.076743364
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.42E-07; Fold-change: -0.573427327; Z-score: -1.081542857
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000118924; Fold-change: -0.119342085; Z-score: -0.111073351
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.085512103; Fold-change: 0.063139673; Z-score: 0.262965118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.76856135; Fold-change: -0.014880327; Z-score: -0.072631257
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.111213329; Fold-change: 0.110586257; Z-score: 0.284636617
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.395568175; Fold-change: -0.093180281; Z-score: -1.262606746
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.424489758; Fold-change: 0.196190832; Z-score: 0.75340056
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.40061042; Fold-change: 0.026139043; Z-score: 0.106500306
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.07272325; Fold-change: 0.104721807; Z-score: 0.389295373
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.32008292; Fold-change: -0.016642974; Z-score: -0.065463972
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.51E-25; Fold-change: -0.511608187; Z-score: -1.056777327
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.52E-55; Fold-change: 1.92183309; Z-score: 7.207087516
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.554762221; Fold-change: -0.105794413; Z-score: -0.677485486
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.385929288; Fold-change: -0.040363012; Z-score: -0.166033066
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.475429528; Fold-change: -0.098766895; Z-score: -0.274461933
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.370797249; Fold-change: 0.118125144; Z-score: 0.355263447
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004107359; Fold-change: 0.07075017; Z-score: 0.85206146
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.278680838; Fold-change: 0.0501455; Z-score: 0.270019099
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.41E-06; Fold-change: 1.217529852; Z-score: 4.633463186
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.167914213; Fold-change: 0.120426729; Z-score: 1.296820113
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.368328846; Fold-change: -0.495586357; Z-score: -0.737499692
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271100147; Fold-change: 0.22297765; Z-score: 0.495592722
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009232582; Fold-change: -0.459921401; Z-score: -1.365282735
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.298870551; Fold-change: -0.095175576; Z-score: -0.405908407
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.68965086; Fold-change: 0.006292021; Z-score: 0.019320424
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.402563216; Fold-change: 0.029433549; Z-score: 0.124612656
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.313734116; Fold-change: 0.038182995; Z-score: 0.247061911
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.65E-06; Fold-change: 0.386657523; Z-score: 1.030877618
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.517367753; Fold-change: 0.132406771; Z-score: 0.323764213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.091147502; Fold-change: -0.408649046; Z-score: -1.909602421
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000492139; Fold-change: 1.385523096; Z-score: 3.147098868
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.51E-06; Fold-change: 0.830662068; Z-score: 4.278279424
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.495862942; Fold-change: -0.367969819; Z-score: -0.409952995
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.21E-45; Fold-change: 1.668097812; Z-score: 1.97421435
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02880893; Fold-change: 0.505490089; Z-score: 0.96696137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.798862873; Fold-change: 0.181768757; Z-score: 0.284895101
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031593816; Fold-change: -0.089240886; Z-score: -0.549200717
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.196051613; Fold-change: -0.046078787; Z-score: -2.066450378
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.100305425; Fold-change: -0.660472208; Z-score: -1.237243288
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.32205302; Fold-change: 0.201414754; Z-score: 0.70940632
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.385458491; Fold-change: 0.085117658; Z-score: 0.429220768
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002157268; Fold-change: 0.096328754; Z-score: 0.769338841
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.093528338; Fold-change: 0.068898025; Z-score: 0.360561363
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.733294484; Fold-change: -0.05471058; Z-score: -0.239248125
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.230600313; Fold-change: -0.103348971; Z-score: -0.544630443
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.134346705; Fold-change: 0.071683228; Z-score: 0.484602609
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.27926816; Fold-change: 0.007764694; Z-score: 0.076197788
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.661761377; Fold-change: 0.165914955; Z-score: 0.296828443
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.098352012; Fold-change: 0.069436918; Z-score: 0.682973867
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.553237622; Fold-change: -0.053335537; Z-score: -0.360130669
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.45770282; Fold-change: -0.150555468; Z-score: -1.04991008
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.898477365; Fold-change: 0.04803612; Z-score: 0.356570299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.238867175; Fold-change: 0.092397027; Z-score: 0.707771334
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02844717; Fold-change: 0.056721126; Z-score: 0.40020658
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.614778749; Fold-change: -0.015913062; Z-score: -0.04439037
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.619135853; Fold-change: -0.005325456; Z-score: -0.029289553
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001082598; Fold-change: -0.244065864; Z-score: -0.399707674
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.939885533; Fold-change: 0.022516796; Z-score: 0.133931478
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006899351; Fold-change: 0.518291952; Z-score: 3.578640551
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.577077697; Fold-change: 0.071537796; Z-score: 0.381754374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.212351037; Fold-change: 0.124207231; Z-score: 0.346886356
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.99537877; Fold-change: -0.072763304; Z-score: -0.108206062
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 SHR-A1403, a novel c-Met antibody-drug conjugate, exerts encouraging anti-tumor activity in c-Met-overexpressing models. Acta Pharmacol Sin. 2019 Jul;40(7):971-979.
Ref 2 Anti-c-met antibody-drug conjugate and applications thereof; 2022-03-10.
Ref 3 High-Affinity Human Anti-c-Met IgG Conjugated to Oxaliplatin as Targeted Chemotherapy for Hepatocellular Carcinoma. Front Oncol. 2019 Aug 2;9:717. doi: 10.3389/fonc.2019.00717. eCollection 2019.
Ref 4 Anti-C-met antibodies and anti-C-met antibodies-cytotoxic drug conjugate and medical usage thereof.
Ref 5 cIRCR201-dPBD, a Novel Pyrrolobenzodiazepine Dimer-Containing Site-Specific Antibody-Drug Conjugate Targeting c-Met Overexpression Tumors. ACS Omega. 2020 Sep 29;5(40):25798-25809. doi: 10.1021/acsomega.0c03102.
Ref 6 TR1801-ADC: a highly potent cMet antibody-drug conjugate with high activity in patient-derived xenograft models of solid tumors. Mol Oncol. 2020 Jan;14(1):54-68. doi: 10.1002/1878-0261.12600. Epub 2019 Dec 3.
Ref 7 Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof; 2020-04-02.
Ref 8 A novel molecule with profound tumor killing activity. Cancer Res (2019) 79 (13_Supplement): 353.
Ref 9 TR1801-ADC: a highly potent cMet antibody-drug conjugate with high activity in patient-derived xenograft models of solid tumors. Mol Oncol. 2020 Jan;14(1):54-68.
Ref 10 MET and RON receptor tyrosine kinases in colorectal adenocarcinoma: molecular features as drug targets and antibody-drug conjugates for therapy. J Exp Clin Cancer Res. 2020 Sep 22;39(1):198. doi: 10.1186/s13046-020-01711-x.
Ref 11 MYTX-011: A novel cMET-targeting antibody drug conjugate (ADC) engineered to increase on-target uptake in and efficacy against cMET expressing tumors. Cancer Res (2023) 83 (7_Supplement): 5000.
Ref 12 A phase 1/2 study of REGN5093-M114, a METxMET antibody-drug conjugate, in patients with mesenchymal epithelial transition factor (MET)-overexpressing NSCLC. Journal of Clinical Oncology 2022 40:16_suppl, TPS8593-TPS8593.
Ref 13 Introduction to basic information on ADC drug C-met monoclonal antibody-drug conjugate
Ref 14 Phase Ib Study of Telisotuzumab Vedotin in Combination With Erlotinib in Patients With c-Met Protein-Expressing Non-Small-Cell Lung Cancer. J Clin Oncol. 2023 Feb 10;41(5):1105-1115.
Ref 15 ANTI-cMet antibody drug conjugates and methods for their use; 2017-11-23.
Ref 16 A Study of RC108-ADC in subjects with advanced digestive system malignant tumor.
Ref 17 Preclinical Profile of BYON3521 Predicts an Effective and Safe MET Antibody-Drug Conjugate. Mol Cancer Ther. 2023 Jun 1;22(6):765-777. doi: 10.1158/1535-7163.MCT-22-0596.
Ref 18 Introduction to basic information on ADC drug APS-3010.
Ref 19 c-Met Antibody Drug Conjugate.
Ref 20 Preclinical evaluation of a new, non-agonist ADC targeting MET-amplified tumors with a peptide-linked maytansinoid. Cancer Res (2019) 79 (13_Supplement): 4817.
Ref 21 Syntab therapeutics biotechnology company product pipeline