Antigen ID	TAR0LTTSS
Antigen Name	Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
Gene Name	ROR1
Gene ID	4919
Synonym	NTRKR1; Neurotrophic tyrosine kinase, receptor-related 1
Sequence	MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG AVTQEQPVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL     Click to Show/Hide
Family	Protein kinase family
Function	Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.     Click to Show/Hide
Uniprot Entry	ROR1_HUMAN
HGNC ID	HGNC:10256
KEGG ID	hsa:4919

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2022253035A1 ADC-27	WO2022253035A1 ADC-27 payload	Undisclosed	WO2022253035A1 ADC-27 linker	[1]
ADC Info	WO2022253035A1 ADC-28	WO2022253035A1 ADC-28 payload	Undisclosed	WO2022253035A1 ADC-28 linker	[1]
ADC Info	WO2022253035A1 ADC-29	WO2022253035A1 ADC-29 payload	Undisclosed	WO2022253035A1 ADC-29 linker	[1]
ADC Info	WO2022253035A1 ADC-30	WO2022253035A1 ADC-30 payload	Undisclosed	WO2022253035A1 ADC-30 linker	[1]
ADC Info	WO2022253035A1 ADC-31	WO2022253035A1 ADC-31 payload	Undisclosed	WO2022253035A1 ADC-31 linker	[1]
ADC Info	WO2022253035A1 ADC-32	WO2022253035A1 ADC-32 payload	Undisclosed	WO2022253035A1 ADC-32 linker	[1]
ADC Info	WO2022253035A1 ADC-33	WO2022253035A1 ADC-33 payload	Undisclosed	WO2022253035A1 ADC-33 linker	[1]
ADC Info	WO2022253035A1 ADC-34	WO2022253035A1 ADC-34 payload	Undisclosed	WO2022253035A1 ADC-34 linker	[1]
ADC Info	WO2022253035A1 ADC-35	WO2022253035A1 ADC-35 payload	Undisclosed	WO2022253035A1 ADC-35 linker	[1]
ADC Info	WO2022253035A1 ADC-36	WO2022253035A1 ADC-36 payload	Undisclosed	WO2022253035A1 ADC-36 linker	[1]
ADC Info	WO2022253035A1 ADC-37	WO2022253035A1 ADC-37 payload	Undisclosed	WO2022253035A1 ADC-37 linker	[1]
ADC Info	WO2022253035A1 ADC-38	WO2022253035A1 ADC-38 payload	Undisclosed	WO2022253035A1 ADC-38 linker	[1]
ADC Info	WO2022253035A1 ADC-39	WO2022253035A1 ADC-39 payload	Undisclosed	WO2022253035A1 ADC-39 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC9	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC9 linker	[2]
ADC Info	WO2021044208A1 ADC10	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC10 linker	[2]
ADC Info	WO2021044208A1 ADC 2A2-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC 2A2-4 linker	[2]
ADC Info	WO2021044208A1 ADC 2A2-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC 2A2-5 linker	[2]
ADC Info	WO2021044208A1 ADC 2A2-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC 2A2-6 linker	[2]
ADC Info	WO2021044208A1 ADC 2A2-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC 2A2-7 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC AB4-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC A2F2-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC A2F2-2 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2-3 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2-4 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2-5 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2-6 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2-7 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F3-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC A2F2 M1-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC A2F2 M1-2 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2 M1-3 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2 M1-4 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F2 M1-5 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2 M1-6 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2 M1-7 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2 M1-7 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC A2F3-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC A2F3-2 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F3-3 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F3-4 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F3-6 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F3-7 linker	[2]
ADC Info	WO2021044208A1 ADC A2F3-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC A2F3-5 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC BA6-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC AB4-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC AB4-2 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC AB4-3 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC AB4-4 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC AB4-5 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC AB4-6 linker	[2]
ADC Info	WO2021044208A1 ADC AB4-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC AB4-7 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC BA6-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC BA6-2 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC BA6-3 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC BA6-4 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC BA6-5 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC BA6-6 linker	[2]
ADC Info	WO2021044208A1 ADC BA6-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC BA6-7 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC CC9-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC2 linker	[2]
ADC Info	WO2021044208A1 ADC3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC3 linker	[2]
ADC Info	WO2021044208A1 ADC4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC4 linker	[2]
ADC Info	WO2021044208A1 ADC5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC5 linker	[2]
ADC Info	WO2021044208A1 ADC6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC6 linker	[2]
ADC Info	WO2021044208A1 ADC7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC7 linker	[2]
ADC Info	WO2021044208A1 ADC8	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC8 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC CC9-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC CC9-2 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC CC9-3 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC CC9-4 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC CC9-5 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC CC9-6 linker	[2]
ADC Info	WO2021044208A1 ADC CC9-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC CC9-7 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC DG6-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC D2B12-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC D2B12-2 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC D2B12-3 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC D2B12-4 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC D2B12-5 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC D2B12-6 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC D2B12-7 linker	[2]
ADC Info	WO2021044208A1 ADC A2F2 M1-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC A2F2 M1-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2021044208A1 ADC DG6-2	Monomethyl auristatin F	Microtubule (MT)	WO2021044208A1_ADC DG6-2 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-3	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC DG6-3 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-5	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC DG6-5 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-6	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC DG6-6 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-7	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC DG6-7 linker	[2]
ADC Info	WO2021044208A1 ADC DG6-4	Monomethyl auristatin E	Microtubule (MT)	WO2021044208A1_ADC DG6-4 linker	[2]
ADC Info	WO2021044208A1 ADC D2B12-1	SG2000	Human Deoxyribonucleic acid (hDNA)	WO2021044208A1_ADC D2B12-1 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	NBE-002	PNU-159682	DNA topoisomerase 2-alpha (TOP2A)	LPETG-Gly5-EDA	[3]
ADC Info	HuXBR1-402-G5-PNU	PNU-159682	DNA topoisomerase 2-alpha (TOP2A)	Gly5-FITC	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Zilovertamab vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[5]
ADC Info	Cirmtuzumab vedotin	Monomethyl auristatin E	Microtubule (MT)	Lysine-linker	[6]
ADC Info	Cirmtuzumab-ADC-7	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	STRO-003	Exatecan	DNA topoisomerase 1 (TOP1)	SC3417	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	LCB-71	Beta-glucuronide-linked pyrrolobenzodiazepine dimer (dPBD)	Human Deoxyribonucleic acid (hDNA)	Geranyl ketone pyrophosphate oxime ligation	[9]
ADC Info	ABL-202	Undisclosed	Undisclosed	Undisclosed	[10]
ADC Info	ELN-11	Undisclosed	Undisclosed	Undisclosed	[11]
ADC Info	Anti-ROR1 antibody scFv conjugate (Oncternal)	Undisclosed	Undisclosed	Undisclosed	[12]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.93E-12; Fold-change: -0.826084081; Z-score: -1.334787457
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007843929; Fold-change: 0.883164061; Z-score: 5.918160843
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013072428; Fold-change: -0.545782353; Z-score: -0.722673976
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.77E-09; Fold-change: 0.827976064; Z-score: 2.69802654
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.28E-49; Fold-change: 0.428403686; Z-score: 0.900144485
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000200039; Fold-change: 0.133978909; Z-score: 0.712492761
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022388587; Fold-change: 0.131792475; Z-score: 0.907952836
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.99070679; Fold-change: -0.009286501; Z-score: -0.059779123
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.408160178; Fold-change: -0.161724466; Z-score: -0.556762303
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.973613124; Fold-change: -0.414277762; Z-score: -0.95945097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.219117018; Fold-change: -1.368103843; Z-score: -1.453792029
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.027009023; Fold-change: -0.183585599; Z-score: -0.452323045
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.11E-09; Fold-change: -0.243034264; Z-score: -0.531507943
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.35E-21; Fold-change: -0.723561038; Z-score: -1.121688097
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.627711263; Fold-change: 0.134759258; Z-score: 0.193770545
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.532974134; Fold-change: 0.124321003; Z-score: 0.193808793
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.57E-07; Fold-change: 0.050744751; Z-score: 0.21562659
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.96E-08; Fold-change: 0.031162498; Z-score: 0.129661672
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.000503694; Fold-change: 0.137801954; Z-score: 1.731463683
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.56E-128; Fold-change: -1.697780142; Z-score: -3.404108944
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.58E-57; Fold-change: -1.592736211; Z-score: -2.47791877
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.084011439; Fold-change: -0.313357841; Z-score: -0.394615962
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.63E-149; Fold-change: 2.251100026; Z-score: 6.04696224
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00107228; Fold-change: 2.297043128; Z-score: 5.81813673
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-39; Fold-change: -0.871585168; Z-score: -1.247947671
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.03E-12; Fold-change: -1.266601372; Z-score: -1.729280156
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.354462119; Fold-change: -1.225886608; Z-score: -0.908383402
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.011029287; Fold-change: -1.759683503; Z-score: -1.218328647
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000268885; Fold-change: -0.303696179; Z-score: -1.443722974
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.68E-05; Fold-change: -0.841335093; Z-score: -1.004380804
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.785892631; Fold-change: -0.642973833; Z-score: -0.666024433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.528583783; Fold-change: 0.295173996; Z-score: 0.489015032
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.023523849; Fold-change: -0.515930057; Z-score: -0.998646737
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.260136948; Fold-change: 0.1708216; Z-score: 0.567333654
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-41; Fold-change: 1.129104399; Z-score: 3.252772444
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.94E-34; Fold-change: 1.215375368; Z-score: 3.695955309
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.20E-05; Fold-change: 0.260835597; Z-score: 1.140725
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.898029611; Fold-change: 0.055459515; Z-score: 0.089135094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000302272; Fold-change: 1.186341805; Z-score: 2.817882407
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031186649; Fold-change: 0.083206028; Z-score: 0.316642608
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.259804048; Fold-change: 0.089207742; Z-score: 0.67825372
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000797561; Fold-change: -0.189849206; Z-score: -0.432207927
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.327682288; Fold-change: 0.11637407; Z-score: 0.408301584
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011268821; Fold-change: -0.275113074; Z-score: -1.162243216
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026814473; Fold-change: -0.113370943; Z-score: -0.939241389
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.85310836; Fold-change: 0.001798112; Z-score: 0.00580084
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200071738; Fold-change: -0.463111216; Z-score: -1.022827586
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.366354433; Fold-change: 0.230928202; Z-score: 2.059071266
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.140711977; Fold-change: 0.009860682; Z-score: 0.035261394
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.555277065; Fold-change: 0.038961954; Z-score: 0.242531307
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.542959043; Fold-change: -0.102942213; Z-score: -0.334402006
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013738681; Fold-change: 0.628024932; Z-score: 5.245673209
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.986552348; Fold-change: 0.044343039; Z-score: 0.219728314
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.848166611; Fold-change: -0.040989163; Z-score: -0.133007249
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.313810635; Fold-change: 0.04192544; Z-score: 0.112928763
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.808278038; Fold-change: -0.107422878; Z-score: -0.488868331
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.94799428; Fold-change: 0.116271529; Z-score: 0.703220779
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.023480442; Fold-change: 0.211325143; Z-score: 0.447056437
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.861303805; Fold-change: 0.042921753; Z-score: 0.266327307
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.791702145; Fold-change: 0.111275128; Z-score: 0.190651727
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.81138517; Fold-change: 0.06724792; Z-score: 0.588663032
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000790374; Fold-change: -1.438914607; Z-score: -6.439994831
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.697141664; Fold-change: 0.006316248; Z-score: 0.039699595
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.041578391; Fold-change: -0.269688999; Z-score: -0.634711388
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077678886; Fold-change: 0.15471718; Z-score: 0.890006754
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.057179607; Fold-change: -0.060027093; Z-score: -0.098222061
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.032296361; Fold-change: -0.144244918; Z-score: -0.343607996
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.270402771; Fold-change: 0.006861615; Z-score: 0.039571381
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.00E-06; Fold-change: 0.133371228; Z-score: 0.320483948
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.719547925; Fold-change: -0.018769156; Z-score: -0.113072398
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009976914; Fold-change: -0.528401929; Z-score: -1.094192625
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.28E-10; Fold-change: -0.699994535; Z-score: -1.149382174
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.022437505; Fold-change: -0.956042896; Z-score: -1.861177082
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040187296; Fold-change: 0.272623031; Z-score: 1.047931447
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.544666732; Fold-change: -0.014211597; Z-score: -0.034265535
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.352968547; Fold-change: 0.059415596; Z-score: 0.192833731
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.588477179; Fold-change: 0.080433702; Z-score: 0.319255203
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.52E-18; Fold-change: -0.627679801; Z-score: -1.217465433
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.56E-08; Fold-change: -0.431390062; Z-score: -1.18917556
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.025456727; Fold-change: -0.308346838; Z-score: -1.40719551
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.232752682; Fold-change: 0.004303023; Z-score: 0.013739566
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.327477947; Fold-change: -0.207132966; Z-score: -1.003533822
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014857082; Fold-change: 1.888429784; Z-score: 2.002438088
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.115657063; Fold-change: 0.063483306; Z-score: 0.417562966
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132603094; Fold-change: -0.051252474; Z-score: -0.175113594
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.94E-07; Fold-change: 1.50734113; Z-score: 4.239535898
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.608255077; Fold-change: 0.073242221; Z-score: 0.212465645
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.206257144; Fold-change: -0.825659494; Z-score: -1.724341406
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.0288837; Fold-change: -0.226062517; Z-score: -0.407569786
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.677906724; Fold-change: 0.11401286; Z-score: 0.2633082
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.450540118; Fold-change: 0.049648699; Z-score: 0.069253563
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002785523; Fold-change: -0.047538528; Z-score: -0.258207369
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.04E-05; Fold-change: -0.533711427; Z-score: -3.365443896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.838521682; Fold-change: 0.058405696; Z-score: 0.390112606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.69E-06; Fold-change: -0.66169846; Z-score: -1.058310133
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.68E-19; Fold-change: -0.719666416; Z-score: -1.224968496
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001179867; Fold-change: -1.77292968; Z-score: -3.22754262
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00371253; Fold-change: -0.640645948; Z-score: -1.934672136
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.137386746; Fold-change: -0.327753373; Z-score: -0.96784376
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.35E-28; Fold-change: -0.782042148; Z-score: -1.28910227
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.34E-31; Fold-change: -0.736366553; Z-score: -1.710237906
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.684560162; Fold-change: 0.599838623; Z-score: 0.420933081
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.80E-21; Fold-change: 0.778498579; Z-score: 1.715713881
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.080170836; Fold-change: -0.682172727; Z-score: -0.783015445
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.391454888; Fold-change: -0.129044428; Z-score: -0.31155459
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.063358078; Fold-change: 0.400022865; Z-score: 2.083596181
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.29548038; Fold-change: -0.088601539; Z-score: -0.387109553
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.170149249; Fold-change: 0.074912632; Z-score: 0.49732035
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003727825; Fold-change: 0.276387055; Z-score: 1.815299734
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.24129849; Fold-change: -0.061770013; Z-score: -0.52204105
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.041002531; Fold-change: 0.148342525; Z-score: 2.566445931
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003022565; Fold-change: 0.24133692; Z-score: 2.580609868
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.060659389; Fold-change: 0.063622289; Z-score: 0.264311367
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.0026991; Fold-change: 0.164195521; Z-score: 1.477165086
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.830088512; Fold-change: 0.025545567; Z-score: 0.132862994
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.167256713; Fold-change: -0.072115636; Z-score: -0.418777934
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.152583711; Fold-change: 0.170851482; Z-score: 0.467683244
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.064044105; Fold-change: 0.348768292; Z-score: 1.196497801
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.193102438; Fold-change: 0.122507017; Z-score: 0.908358965
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.106719447; Fold-change: -0.035672427; Z-score: -0.189863094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079300621; Fold-change: -0.100153329; Z-score: -0.297930632
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.795898789; Fold-change: 0.080265335; Z-score: 0.332472279
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.956766776; Fold-change: -0.037996391; Z-score: -0.332448874
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002355625; Fold-change: 0.138822172; Z-score: 0.52855994
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.273029203; Fold-change: -0.157265313; Z-score: -0.877224115
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.384922194; Fold-change: -0.742100975; Z-score: -0.556963526
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.513566389; Fold-change: 0.126035264; Z-score: 0.281432699
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.45E-07; Fold-change: 0.843676273; Z-score: 2.573308069
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.269863417; Fold-change: 0.072619678; Z-score: 0.267994148
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Antibody drug conjugate, and preparation method therefor and use thereof; 2022-12-08.
Ref 2	Antibody-drug conjugate comprising antibody against human ror1, and use for the same; 2021-04-01.
Ref 3	NBE-002: A novel anthracycline-based antibody-drug conjugate (ADC) targeting ROR1 for the treatment of advanced solid tumorsA phase 1/2 clinical trial. Journal of Clinical Oncology 39, no. 15_suppl.
Ref 4	The ROR1 antibody-drug conjugate huXBR1-402-G5-PNU effectively targets ROR1+ leukemia. Blood Adv. 2021 Aug 24;5(16):3152-3162.
Ref 5	Zilovertamab Vedotin Targeting of ROR1 as Therapy for Lymphoid Cancers. NEJM Evidence. 2021;1(1). doi: DOI: 10.1056/EVIDoa2100001.
Ref 6	Cirmtuzumab Vedotin (UC-961ADC3), An Anti-ROR1-Monomethyl Auristatin E Antibody-Drug Conjugate, Is a Potential Treatment For ROR1-Positive Leukemia and Solid Tumors. Blood (2013) 122 (21): 1637.
Ref 7	Development of Cirmtuzumab Antibody-Drug Conjugates (ADCs) Targeting Receptor Tyrosine Kinase-like Orphan Receptor 1 (ROR1). Blood. 2018 ;132():-. doi: 10.1182/blood-2018-99-119447.
Ref 8	STRO-003 is a novel ROR1-targeted ADC for breast and lung cancer. Journal for ImmunoTherapy of Cancer 2022;10:doi: 10.1136/jitc-2022-SITC2022.1191.
Ref 9	CStone and LegoChem Biosciences Enter Global Licensing Agreement for New Antibody Drug Conjugate; 29 Oct 2020.
Ref 10	Introduction to basic information on ADC drug ABL-202
Ref 11	Introduction to basic information on ADC drug ELN 11- Almac Discovery/Elasmogen.
Ref 12	ROR1: an orphan becomes apparent. Blood. 2022 Oct 6;140(14):1583-1591. doi: 10.1182/blood.2021014760.