General Information of This Antigen
Antigen ID
TAR0LTTSS
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
Gene Name
ROR1
Gene ID
4919
Synonym
NTRKR1; Neurotrophic tyrosine kinase, receptor-related 1
Sequence
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL
LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL

    Click to Show/Hide
Family
Protein kinase family
Function
Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.

    Click to Show/Hide
Uniprot Entry
ROR1_HUMAN
HGNC ID
HGNC:10256
KEGG ID
hsa:4919
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
19F6_Hu35v1
ADC Info ADC Name Payload Target Linker Ref
WO2022253035A1 ADC-27
WO2022253035A1 ADC-27 payload
Undisclosed
WO2022253035A1 ADC-27 linker
[1]
WO2022253035A1 ADC-28
WO2022253035A1 ADC-28 payload
Undisclosed
WO2022253035A1 ADC-28 linker
[1]
WO2022253035A1 ADC-29
WO2022253035A1 ADC-29 payload
Undisclosed
WO2022253035A1 ADC-29 linker
[1]
WO2022253035A1 ADC-30
WO2022253035A1 ADC-30 payload
Undisclosed
WO2022253035A1 ADC-30 linker
[1]
WO2022253035A1 ADC-31
WO2022253035A1 ADC-31 payload
Undisclosed
WO2022253035A1 ADC-31 linker
[1]
WO2022253035A1 ADC-32
WO2022253035A1 ADC-32 payload
Undisclosed
WO2022253035A1 ADC-32 linker
[1]
WO2022253035A1 ADC-33
WO2022253035A1 ADC-33 payload
Undisclosed
WO2022253035A1 ADC-33 linker
[1]
WO2022253035A1 ADC-34
WO2022253035A1 ADC-34 payload
Undisclosed
WO2022253035A1 ADC-34 linker
[1]
WO2022253035A1 ADC-35
WO2022253035A1 ADC-35 payload
Undisclosed
WO2022253035A1 ADC-35 linker
[1]
WO2022253035A1 ADC-36
WO2022253035A1 ADC-36 payload
Undisclosed
WO2022253035A1 ADC-36 linker
[1]
WO2022253035A1 ADC-37
WO2022253035A1 ADC-37 payload
Undisclosed
WO2022253035A1 ADC-37 linker
[1]
WO2022253035A1 ADC-38
WO2022253035A1 ADC-38 payload
Undisclosed
WO2022253035A1 ADC-38 linker
[1]
WO2022253035A1 ADC-39
WO2022253035A1 ADC-39 payload
Undisclosed
WO2022253035A1 ADC-39 linker
[1]
A human anti-ROR1 IgG1 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
CS5001
Prodrug pyrrolobenzodiazepine dimer
Human Deoxyribonucleic acid (hDNA)
b-glucuronide linker
[2]
Anti-ROR1 mAb 2A2
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC 2A2-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC 2A2-4 linker
[3]
WO2021044208A1 ADC 2A2-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC 2A2-5 linker
[3]
WO2021044208A1 ADC 2A2-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC 2A2-6 linker
[3]
WO2021044208A1 ADC 2A2-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC 2A2-7 linker
[3]
WO2021044208A1 ADC AB4-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC AB4-1 linker
[3]
WO2021044208A1 ADC10
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC10 linker
[3]
WO2021044208A1 ADC9
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC9 linker
[3]
Anti-ROR1 mAb A2F2
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC A2F2-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC A2F2-2 linker
[3]
WO2021044208A1 ADC A2F2-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2-3 linker
[3]
WO2021044208A1 ADC A2F2-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2-4 linker
[3]
WO2021044208A1 ADC A2F2-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2-5 linker
[3]
WO2021044208A1 ADC A2F2-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2-6 linker
[3]
WO2021044208A1 ADC A2F2-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2-7 linker
[3]
WO2021044208A1 ADC A2F3-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F3-1 linker
[3]
Anti-ROR1 mAb A2F2 M1
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC A2F2 M1-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2 M1-6 linker
[3]
WO2021044208A1 ADC A2F2 M1-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2 M1-7 linker
[3]
WO2021044208A1 ADC A2F2 M1-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC A2F2 M1-2 linker
[3]
WO2021044208A1 ADC A2F2 M1-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2 M1-3 linker
[3]
WO2021044208A1 ADC A2F2 M1-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2 M1-4 linker
[3]
WO2021044208A1 ADC A2F2 M1-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F2 M1-5 linker
[3]
WO2021044208A1 ADC A2F2 M1-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2 M1-7 linker
[3]
Anti-ROR1 mAb A2F3
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC A2F3-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC A2F3-2 linker
[3]
WO2021044208A1 ADC A2F3-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F3-3 linker
[3]
WO2021044208A1 ADC A2F3-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F3-4 linker
[3]
WO2021044208A1 ADC A2F3-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC A2F3-5 linker
[3]
WO2021044208A1 ADC A2F3-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F3-6 linker
[3]
WO2021044208A1 ADC A2F3-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F3-7 linker
[3]
WO2021044208A1 ADC BA6-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC BA6-1 linker
[3]
Anti-ROR1 mAb AB4
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC A2F2-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2-1 linker
[3]
WO2021044208A1 ADC AB4-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC AB4-2 linker
[3]
WO2021044208A1 ADC AB4-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC AB4-3 linker
[3]
WO2021044208A1 ADC AB4-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC AB4-4 linker
[3]
WO2021044208A1 ADC AB4-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC AB4-5 linker
[3]
WO2021044208A1 ADC AB4-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC AB4-6 linker
[3]
WO2021044208A1 ADC AB4-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC AB4-7 linker
[3]
Anti-ROR1 mAb BA6
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC BA6-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC BA6-2 linker
[3]
WO2021044208A1 ADC BA6-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC BA6-3 linker
[3]
WO2021044208A1 ADC BA6-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC BA6-4 linker
[3]
WO2021044208A1 ADC BA6-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC BA6-5 linker
[3]
WO2021044208A1 ADC BA6-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC BA6-6 linker
[3]
WO2021044208A1 ADC BA6-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC BA6-7 linker
[3]
WO2021044208A1 ADC CC9-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC CC9-1 linker
[3]
Anti-ROR1 mAb C2E3
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC2 linker
[3]
WO2021044208A1 ADC3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC3 linker
[3]
WO2021044208A1 ADC4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC4 linker
[3]
WO2021044208A1 ADC5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC5 linker
[3]
WO2021044208A1 ADC6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC6 linker
[3]
WO2021044208A1 ADC7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC7 linker
[3]
WO2021044208A1 ADC8
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC8 linker
[3]
Anti-ROR1 mAb CC9
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC CC9-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC CC9-2 linker
[3]
WO2021044208A1 ADC CC9-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC CC9-3 linker
[3]
WO2021044208A1 ADC CC9-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC CC9-4 linker
[3]
WO2021044208A1 ADC CC9-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC CC9-5 linker
[3]
WO2021044208A1 ADC CC9-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC CC9-6 linker
[3]
WO2021044208A1 ADC CC9-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC CC9-7 linker
[3]
WO2021044208A1 ADC DG6-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC DG6-1 linker
[3]
Anti-ROR1 mAb D2B12
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC A2F2 M1-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC A2F2 M1-1 linker
[3]
WO2021044208A1 ADC D2B12-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC D2B12-2 linker
[3]
WO2021044208A1 ADC D2B12-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC D2B12-3 linker
[3]
WO2021044208A1 ADC D2B12-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC D2B12-4 linker
[3]
WO2021044208A1 ADC D2B12-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC D2B12-5 linker
[3]
WO2021044208A1 ADC D2B12-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC D2B12-6 linker
[3]
WO2021044208A1 ADC D2B12-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC D2B12-7 linker
[3]
Anti-ROR1 mAb DG6
ADC Info ADC Name Payload Target Linker Ref
WO2021044208A1 ADC D2B12-1
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC D2B12-1 linker
[3]
WO2021044208A1 ADC DG6-2
Monomethyl auristatin F
Microtubule (MT)
WO2021044208A1_ADC DG6-2 linker
[3]
WO2021044208A1 ADC DG6-3
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC DG6-3 linker
[3]
WO2021044208A1 ADC DG6-4
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC DG6-4 linker
[3]
WO2021044208A1 ADC DG6-5
Monomethyl auristatin E
Microtubule (MT)
WO2021044208A1_ADC DG6-5 linker
[3]
WO2021044208A1 ADC DG6-6
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC DG6-6 linker
[3]
WO2021044208A1 ADC DG6-7
SG2000
Human Deoxyribonucleic acid (hDNA)
WO2021044208A1_ADC DG6-7 linker
[3]
Anti-ROR1 mAb huXBR1-402
ADC Info ADC Name Payload Target Linker Ref
NBE-002
PNU-159682
DNA topoisomerase 2-alpha (TOP2A)
LPETG-Gly5-EDA
[4]
HuXBR1-402-G5-PNU
PNU-159682
DNA topoisomerase 2-alpha (TOP2A)
Gly5-FITC
[5]
Cirmtuzumab
ADC Info ADC Name Payload Target Linker Ref
Zilovertamab vedotin
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[6]
Cirmtuzumab vedotin
Monomethyl auristatin E
Microtubule (MT)
Lysine-linker
[7]
Cirmtuzumab-ADC-7
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[8]
ADC Info ADC Name Payload Target Linker Ref
STRO-003
Exatecan
DNA topoisomerase 1 (TOP1)
SC3417
[9]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
HDM-2005
Undisclosed
Microtubule (MT)
Undisclosed
ELN-11
Undisclosed
Undisclosed
Undisclosed
[10]
Anti-ROR1 antibody scFv conjugate (Oncternal)
Undisclosed
Undisclosed
Undisclosed
[11]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.93E-12; Fold-change: -0.826084081; Z-score: -1.334787457
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007843929; Fold-change: 0.883164061; Z-score: 5.918160843
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013072428; Fold-change: -0.545782353; Z-score: -0.722673976
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.77E-09; Fold-change: 0.827976064; Z-score: 2.69802654
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.28E-49; Fold-change: 0.428403686; Z-score: 0.900144485
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000200039; Fold-change: 0.133978909; Z-score: 0.712492761
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022388587; Fold-change: 0.131792475; Z-score: 0.907952836
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.99070679; Fold-change: -0.009286501; Z-score: -0.059779123
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.408160178; Fold-change: -0.161724466; Z-score: -0.556762303
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.973613124; Fold-change: -0.414277762; Z-score: -0.95945097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.219117018; Fold-change: -1.368103843; Z-score: -1.453792029
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.027009023; Fold-change: -0.183585599; Z-score: -0.452323045
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.11E-09; Fold-change: -0.243034264; Z-score: -0.531507943
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.35E-21; Fold-change: -0.723561038; Z-score: -1.121688097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.627711263; Fold-change: 0.134759258; Z-score: 0.193770545
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.532974134; Fold-change: 0.124321003; Z-score: 0.193808793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.57E-07; Fold-change: 0.050744751; Z-score: 0.21562659
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.96E-08; Fold-change: 0.031162498; Z-score: 0.129661672
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.000503694; Fold-change: 0.137801954; Z-score: 1.731463683
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.56E-128; Fold-change: -1.697780142; Z-score: -3.404108944
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.58E-57; Fold-change: -1.592736211; Z-score: -2.47791877
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.084011439; Fold-change: -0.313357841; Z-score: -0.394615962
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.63E-149; Fold-change: 2.251100026; Z-score: 6.04696224
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00107228; Fold-change: 2.297043128; Z-score: 5.81813673
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.38E-39; Fold-change: -0.871585168; Z-score: -1.247947671
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.03E-12; Fold-change: -1.266601372; Z-score: -1.729280156
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.354462119; Fold-change: -1.225886608; Z-score: -0.908383402
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.011029287; Fold-change: -1.759683503; Z-score: -1.218328647
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000268885; Fold-change: -0.303696179; Z-score: -1.443722974
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.68E-05; Fold-change: -0.841335093; Z-score: -1.004380804
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.785892631; Fold-change: -0.642973833; Z-score: -0.666024433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.528583783; Fold-change: 0.295173996; Z-score: 0.489015032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.023523849; Fold-change: -0.515930057; Z-score: -0.998646737
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.260136948; Fold-change: 0.1708216; Z-score: 0.567333654
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.09E-41; Fold-change: 1.129104399; Z-score: 3.252772444
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.94E-34; Fold-change: 1.215375368; Z-score: 3.695955309
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 4.20E-05; Fold-change: 0.260835597; Z-score: 1.140725
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.898029611; Fold-change: 0.055459515; Z-score: 0.089135094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000302272; Fold-change: 1.186341805; Z-score: 2.817882407
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031186649; Fold-change: 0.083206028; Z-score: 0.316642608
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.259804048; Fold-change: 0.089207742; Z-score: 0.67825372
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000797561; Fold-change: -0.189849206; Z-score: -0.432207927
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.327682288; Fold-change: 0.11637407; Z-score: 0.408301584
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011268821; Fold-change: -0.275113074; Z-score: -1.162243216
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.026814473; Fold-change: -0.113370943; Z-score: -0.939241389
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.85310836; Fold-change: 0.001798112; Z-score: 0.00580084
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.200071738; Fold-change: -0.463111216; Z-score: -1.022827586
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.366354433; Fold-change: 0.230928202; Z-score: 2.059071266
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.140711977; Fold-change: 0.009860682; Z-score: 0.035261394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.555277065; Fold-change: 0.038961954; Z-score: 0.242531307
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.542959043; Fold-change: -0.102942213; Z-score: -0.334402006
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013738681; Fold-change: 0.628024932; Z-score: 5.245673209
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.986552348; Fold-change: 0.044343039; Z-score: 0.219728314
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.848166611; Fold-change: -0.040989163; Z-score: -0.133007249
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.313810635; Fold-change: 0.04192544; Z-score: 0.112928763
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.808278038; Fold-change: -0.107422878; Z-score: -0.488868331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.94799428; Fold-change: 0.116271529; Z-score: 0.703220779
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.023480442; Fold-change: 0.211325143; Z-score: 0.447056437
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.861303805; Fold-change: 0.042921753; Z-score: 0.266327307
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.791702145; Fold-change: 0.111275128; Z-score: 0.190651727
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.81138517; Fold-change: 0.06724792; Z-score: 0.588663032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000790374; Fold-change: -1.438914607; Z-score: -6.439994831
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.697141664; Fold-change: 0.006316248; Z-score: 0.039699595
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.041578391; Fold-change: -0.269688999; Z-score: -0.634711388
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.077678886; Fold-change: 0.15471718; Z-score: 0.890006754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.057179607; Fold-change: -0.060027093; Z-score: -0.098222061
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.032296361; Fold-change: -0.144244918; Z-score: -0.343607996
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.270402771; Fold-change: 0.006861615; Z-score: 0.039571381
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.00E-06; Fold-change: 0.133371228; Z-score: 0.320483948
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.719547925; Fold-change: -0.018769156; Z-score: -0.113072398
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009976914; Fold-change: -0.528401929; Z-score: -1.094192625
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.28E-10; Fold-change: -0.699994535; Z-score: -1.149382174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.022437505; Fold-change: -0.956042896; Z-score: -1.861177082
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040187296; Fold-change: 0.272623031; Z-score: 1.047931447
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.544666732; Fold-change: -0.014211597; Z-score: -0.034265535
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.352968547; Fold-change: 0.059415596; Z-score: 0.192833731
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.588477179; Fold-change: 0.080433702; Z-score: 0.319255203
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.52E-18; Fold-change: -0.627679801; Z-score: -1.217465433
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.56E-08; Fold-change: -0.431390062; Z-score: -1.18917556
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025456727; Fold-change: -0.308346838; Z-score: -1.40719551
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.232752682; Fold-change: 0.004303023; Z-score: 0.013739566
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.327477947; Fold-change: -0.207132966; Z-score: -1.003533822
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014857082; Fold-change: 1.888429784; Z-score: 2.002438088
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.115657063; Fold-change: 0.063483306; Z-score: 0.417562966
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.132603094; Fold-change: -0.051252474; Z-score: -0.175113594
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.94E-07; Fold-change: 1.50734113; Z-score: 4.239535898
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.608255077; Fold-change: 0.073242221; Z-score: 0.212465645
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.206257144; Fold-change: -0.825659494; Z-score: -1.724341406
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.0288837; Fold-change: -0.226062517; Z-score: -0.407569786
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.677906724; Fold-change: 0.11401286; Z-score: 0.2633082
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.450540118; Fold-change: 0.049648699; Z-score: 0.069253563
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002785523; Fold-change: -0.047538528; Z-score: -0.258207369
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.04E-05; Fold-change: -0.533711427; Z-score: -3.365443896
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838521682; Fold-change: 0.058405696; Z-score: 0.390112606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.69E-06; Fold-change: -0.66169846; Z-score: -1.058310133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.68E-19; Fold-change: -0.719666416; Z-score: -1.224968496
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001179867; Fold-change: -1.77292968; Z-score: -3.22754262
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00371253; Fold-change: -0.640645948; Z-score: -1.934672136
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.137386746; Fold-change: -0.327753373; Z-score: -0.96784376
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.35E-28; Fold-change: -0.782042148; Z-score: -1.28910227
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.34E-31; Fold-change: -0.736366553; Z-score: -1.710237906
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.684560162; Fold-change: 0.599838623; Z-score: 0.420933081
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.80E-21; Fold-change: 0.778498579; Z-score: 1.715713881
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.080170836; Fold-change: -0.682172727; Z-score: -0.783015445
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.391454888; Fold-change: -0.129044428; Z-score: -0.31155459
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.063358078; Fold-change: 0.400022865; Z-score: 2.083596181
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.29548038; Fold-change: -0.088601539; Z-score: -0.387109553
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.170149249; Fold-change: 0.074912632; Z-score: 0.49732035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003727825; Fold-change: 0.276387055; Z-score: 1.815299734
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.24129849; Fold-change: -0.061770013; Z-score: -0.52204105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.041002531; Fold-change: 0.148342525; Z-score: 2.566445931
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003022565; Fold-change: 0.24133692; Z-score: 2.580609868
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060659389; Fold-change: 0.063622289; Z-score: 0.264311367
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.0026991; Fold-change: 0.164195521; Z-score: 1.477165086
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.830088512; Fold-change: 0.025545567; Z-score: 0.132862994
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.167256713; Fold-change: -0.072115636; Z-score: -0.418777934
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.152583711; Fold-change: 0.170851482; Z-score: 0.467683244
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.064044105; Fold-change: 0.348768292; Z-score: 1.196497801
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.193102438; Fold-change: 0.122507017; Z-score: 0.908358965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.106719447; Fold-change: -0.035672427; Z-score: -0.189863094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.079300621; Fold-change: -0.100153329; Z-score: -0.297930632
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.795898789; Fold-change: 0.080265335; Z-score: 0.332472279
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.956766776; Fold-change: -0.037996391; Z-score: -0.332448874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002355625; Fold-change: 0.138822172; Z-score: 0.52855994
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.273029203; Fold-change: -0.157265313; Z-score: -0.877224115
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.384922194; Fold-change: -0.742100975; Z-score: -0.556963526
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.513566389; Fold-change: 0.126035264; Z-score: 0.281432699
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.45E-07; Fold-change: 0.843676273; Z-score: 2.573308069
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.269863417; Fold-change: 0.072619678; Z-score: 0.267994148
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Antibody drug conjugate, and preparation method therefor and use thereof; 2022-12-08.
Ref 2 CStone and LegoChem Biosciences Enter Global Licensing Agreement for New Antibody Drug Conjugate; 29 Oct 2020.
Ref 3 Antibody-drug conjugate comprising antibody against human ror1, and use for the same; 2021-04-01.
Ref 4 NBE-002: A novel anthracycline-based antibody-drug conjugate (ADC) targeting ROR1 for the treatment of advanced solid tumorsA phase 1/2 clinical trial. Journal of Clinical Oncology 39, no. 15_suppl.
Ref 5 The ROR1 antibody-drug conjugate huXBR1-402-G5-PNU effectively targets ROR1+ leukemia. Blood Adv. 2021 Aug 24;5(16):3152-3162.
Ref 6 Zilovertamab Vedotin Targeting of ROR1 as Therapy for Lymphoid Cancers. NEJM Evidence. 2021;1(1). doi: DOI: 10.1056/EVIDoa2100001.
Ref 7 Cirmtuzumab Vedotin (UC-961ADC3), An Anti-ROR1-Monomethyl Auristatin E Antibody-Drug Conjugate, Is a Potential Treatment For ROR1-Positive Leukemia and Solid Tumors. Blood (2013) 122 (21): 1637.
Ref 8 Development of Cirmtuzumab Antibody-Drug Conjugates (ADCs) Targeting Receptor Tyrosine Kinase-like Orphan Receptor 1 (ROR1). Blood. 2018 ;132():-. doi: 10.1182/blood-2018-99-119447.
Ref 9 STRO-003 is a novel ROR1-targeted ADC for breast and lung cancer. Journal for ImmunoTherapy of Cancer 2022;10:doi: 10.1136/jitc-2022-SITC2022.1191.
Ref 10 Introduction to basic information on ADC drug ELN 11- Almac Discovery/Elasmogen.
Ref 11 ROR1: an orphan becomes apparent. Blood. 2022 Oct 6;140(14):1583-1591. doi: 10.1182/blood.2021014760.