Target Information
General Information of This Target
| Target ID | PATR0DYRGS |
|||||
|---|---|---|---|---|---|---|
| Target Name | Eukaryotic elongation factor 2 kinase (EEF2K) |
|||||
| Gene Name | EEF2K |
|||||
| Gene ID | ||||||
| Synonym | Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase |
|||||
| Sequence |
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW AQMEE Click to Show/Hide
|
|||||
| Family | the protein kinase superfamily, Alpha-type |
|||||
| Function |
Threonine kinase that regulates protein synthesis by controlling the rate of peptide chain elongation. Upon activation by a variety of upstream kinases including AMPK or TRPM7, phosphorylates the elongation factor EEF2 at a single site, renders it unable to bind ribosomes and thus inactive. In turn, the rate of protein synthesis is reduced.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Full List of The ADC Related to This Target
Investigative
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
A43-PE24 |
Anti-GPC3 mAb A43 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
HN3-PE24 |
Anti-GPC3 mAb HN3 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
C46-PE24 |
Anti-GPC3 mAb C46 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
J80A-PE24 |
Anti-GPC3 mAb J80A |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
H8R23-DT3C |
Anti-ANTXR2 mAb H8R23 |
Anthrax toxin receptor 2 (ANTXR2) |
Diphtheria toxin containing streptococcal protein G (DT3C) |
Undisclosed |
[2] | |
A5-PE24 |
Anti-GPC3 mAb A5 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
J80B-PE24 |
Anti-GPC3 mAb J80B |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
I82-PE24 |
Anti-GPC3 mAb I82 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
A18-PE24 |
Anti-GPC3 mAb A18 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
H49-PE24 |
Anti-GPC3 mAb H49 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
G15-PE24 |
Anti-GPC3 mAb G15 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
F5-PE24 |
Anti-GPC3 mAb F5 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
J58-PE24 |
Anti-GPC3 mAb J58 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
F67-PE24 |
Anti-GPC3 mAb F67 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
I34-PE24 |
Anti-GPC3 mAb I34 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
I88-PE24 |
Anti-GPC3 mAb I88 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
R6-PE24 |
Anti-GPC3 mAb R6 |
Glypican-3 (GPC3) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[1] | |
DVHH6-PE38 |
Humanized CD7 nanobody Dvhh6 |
T-cell antigen CD7 (CD7) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[3] | |
Anti-Tac (Fv)-PE38KDEL conjugate |
Anti-Tac (Fv) |
Interleukin-1 receptor type 2 (IL1R2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[4] | |
LMB-75 |
Undisclosed |
Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[5] | |
LMB-70 |
Undisclosed |
Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[6] | |
VGRNb-DT |
Anti-VEGFR-2 nanobody |
Vascular endothelial growth factor receptor 2 (KDR) |
Diphtheria toxin |
Sulfo-SMCC |
[7] | |
DT390 anti-CD3sFv immunotoxin |
Anti-CD3 single-chain Fv |
Myeloid cell surface antigen CD33 (CD33) |
DT390 |
Undisclosed |
[8] | |
Labetuzumab-PE40 conjugate |
Labetuzumab |
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) |
Pseudomonas exotoxin PE40 |
Undisclosed |
[9] | |
GD17-PE40 |
GD17 mAb |
Endoplasmic reticulum chaperone BiP (HSPA5) |
Pseudomonas exotoxin PE40 |
Undisclosed |
[10] | |
G28-5 sFv-PE40 |
Anti-human CD40 MoAb G28-5 |
Tumor necrosis factor receptor superfamily member 5 (CD40) |
Pseudomonas exotoxin PE40 |
Undisclosed |
[11] | |
DVHH6-PE-LR |
Humanized CD7 nanobody Dvhh6 |
T-cell antigen CD7 (CD7) |
Pseudomonas exotoxin PE38 with protease-resistant (PE-LR) |
Undisclosed |
[3] | |
DhuVHH6-PE-LR |
dhuVHH6 |
T-cell antigen CD7 (CD7) |
Pseudomonas exotoxin PE38 with protease-resistant (PE-LR) |
Undisclosed |
[3] | |
HSL156 mAb-DT3C conjugate |
HSL156 |
Junctional adhesion molecule C (JAM3) |
Diphtheria toxin containing streptococcal protein G (DT3C) |
Undisclosed |
[12] | |
scFv (Herceptin)-PE |
Trastuzumab scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[13] | |
scFv(Herceptin)-PE-STXA |
Trastuzumab scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
PE15-Stx 2a |
Undisclosed |
[13] | |
ScFv(trastuzumab)-PE38KDEL |
Trastuzumab scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[14] | |
ScFv(H32)-PE38KDEL |
Anti-HER2 IgG1(H32) scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[14] | |
ScFv(GH2-20)-PE38KDEL |
Anti-HER2 IgG1(GH2-20) scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[14] | |
ScFv(GH2-61)-PE38KDEL |
Anti-HER2 IgG1(GH2-61) scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[14] | |
ScFv(GH2-75)-PE38KDEL |
Anti-HER2 IgG1(GH2-75) scFv |
Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Pseudomonas exotoxin PE38 |
Undisclosed |
[14] | |
LMB-100 |
Anti-MSLN scFv |
Mesothelin (MSLN) |
Pseudomonas exotoxin LO10R456A |
Undisclosed |
[15] | |
LMB-12 |
Anti-MSLN scFv |
Mesothelin (MSLN) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[15] | |
LMB-164 |
Anti-MSLN scFv |
Mesothelin (MSLN) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[15] | |
HD7-1 (VL-VH)-PE40 |
Anti-PSMA mAb hD7-1 |
Glutamate carboxypeptidase 2 (FOLH1) |
Pseudomonas exotoxin PE40 |
Undisclosed |
[16] | |
HD7-1 (VL-VH)-PE24 |
Anti-PSMA mAb hD7-1 |
Glutamate carboxypeptidase 2 (FOLH1) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[16] | |
HD7-1 (VL-VH)-PE24mut |
Anti-PSMA mAb hD7-1 |
Glutamate carboxypeptidase 2 (FOLH1) |
Pseudomonas exotoxin PE24 mut |
Undisclosed |
[16] | |
RG7787 |
Anti-MSLN Anti-ody Fab fragment |
Mesothelin (MSLN) |
Pseudomonas exotoxin PE24 |
Undisclosed |
[17] |
Investigative(Terminated)
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
Monoclonal antibody B3-Lys-PE40 conjugate |
Murine mAb B3 |
Poly [ADP-ribose] polymerase 1 (PARP1) |
LysPE40 |
Undisclosed |
[18] | |
Monoclonal antibody C242-PE conjugate |
Anti-CD138 mAb C242 |
Mucin-1 (MUC1) |
Pseudomonas exotoxin PE40 |
Undisclosed |
[19] |
References
