Target Information

General Information of This Target

Target ID	PATR0DYRGS
Target Name	Eukaryotic elongation factor 2 (EEF2)
Gene Name	EEF2
Gene ID	1938
Synonym	EF2; EF-2
Sequence	MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK RKGLKEGIPALDNFLDKL Click to Show/Hide
Family	TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family
Function	Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Click to Show/Hide
Uniprot Entry	EF2_HUMAN
HGNC ID	HGNC:3214
KEGG ID	hsa:1938

Full List of The ADC Related to This Target

Approved

Click To Hide/Show 1 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Moxetumomab pasudotox	Moxetumomab	CD22	Pseudomonas exotoxin PE38	Mc-Val-Cit-PABC	[1]

Phase 3

Click To Hide/Show 1 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Oportuzumab monatox	Oportuzumab	EPCAM	Pseudomonas exotoxin ETA-252-608	Undisclosed	[2]

Clinical candidate

Click To Hide/Show 6 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	DT390 anti-CD3sFv immunotoxin	Anti-CD3 single-chain Fv	CD33	DT390	Undisclosed	[3]
ADC Info	Anti-Tac (Fv)-PE38KDEL conjugate	Anti-Tac (Fv)	IL1R2	Pseudomonas exotoxin PE38	Undisclosed	[4]
ADC Info	Labetuzumab-PE40 conjugate	Labetuzumab	CEACAM5	Pseudomonas exotoxin PE40	Undisclosed	[5]
ADC Info	G28-5 sFv-PE40	Anti-human CD40 MoAb G28-5	CD40	Pseudomonas exotoxin PE40	Undisclosed	[6]
ADC Info	LMB-75	Undisclosed	TNFRSF17	Pseudomonas exotoxin PE24	Undisclosed	[7]
ADC Info	LMB-70	Undisclosed	TNFRSF17	Pseudomonas exotoxin PE24	Undisclosed	[8]

Investigative

Click To Hide/Show 37 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	LMB-100	Anti-MSLN scFv	MSLN	Pseudomonas exotoxin LO10R456A	Undisclosed	[9]
ADC Info	hD7-1 (VL-VH)-PE24mut	Anti-PSMA mAb hD7-1	FOLH1	Pseudomonas exotoxin PE24 mut	Undisclosed	[10]
ADC Info	VGRNb-DT	Anti-VEGFR-2 nanobody	KDR	Diphtheria toxin	Sulfo-SMCC	[11]
ADC Info	scFv(Herceptin)-PE-STXA	Trastuzumab scFv	ERBB2	PE15-Stx 2a	Undisclosed	[12]
ADC Info	H8R23-DT3C	Anti-ANTXR2 mAb H8R23	ANTXR2	Diphtheria toxin containing streptococcal protein G (DT3C)	Undisclosed	[13]
ADC Info	HSL156 mAb-DT3C conjugate	HSL156	JAM3	Diphtheria toxin containing streptococcal protein G (DT3C)	Undisclosed	[14]
ADC Info	DVHH6-PE38	Humanized CD7 nanobody Dvhh6	CD7	Pseudomonas exotoxin PE38	Undisclosed	[15]
ADC Info	scFv (Herceptin)-PE	Trastuzumab scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[12]
ADC Info	scFv(trastuzumab)-PE38KDEL	Trastuzumab scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[16]
ADC Info	scFv(H32)-PE38KDEL	Anti-HER2 IgG1(H32) scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[16]
ADC Info	scFv(GH2-20)-PE38KDEL	Anti-HER2 IgG1(GH2-20) scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[16]
ADC Info	scFv(GH2-61)-PE38KDEL	Anti-HER2 IgG1(GH2-61) scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[16]
ADC Info	scFv(GH2-75)-PE38KDEL	Anti-HER2 IgG1(GH2-75) scFv	ERBB2	Pseudomonas exotoxin PE38	Undisclosed	[16]
ADC Info	DVHH6-PE-LR	Humanized CD7 nanobody Dvhh6	CD7	Pseudomonas exotoxin PE38 with protease-resistant (PE-LR)	Undisclosed	[15]
ADC Info	DhuVHH6-PE-LR	dhuVHH6	CD7	Pseudomonas exotoxin PE38 with protease-resistant (PE-LR)	Undisclosed	[15]
ADC Info	GD17-PE40	GD17 mAb	HSPA5	Pseudomonas exotoxin PE40	Undisclosed	[17]
ADC Info	hD7-1 (VL-VH)-PE40	Anti-PSMA mAb hD7-1	FOLH1	Pseudomonas exotoxin PE40	Undisclosed	[10]
ADC Info	A43-PE24	Anti-GPC3 mAb A43	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	HN3-PE24	Anti-GPC3 mAb HN3	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	C46-PE24	Anti-GPC3 mAb C46	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	J80A-PE24	Anti-GPC3 mAb J80A	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	A5-PE24	Anti-GPC3 mAb A5	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	J80B-PE24	Anti-GPC3 mAb J80B	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	I82-PE24	Anti-GPC3 mAb I82	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	A18-PE24	Anti-GPC3 mAb A18	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	H49-PE24	Anti-GPC3 mAb H49	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	G15-PE24	Anti-GPC3 mAb G15	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	F5-PE24	Anti-GPC3 mAb F5	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	J58-PE24	Anti-GPC3 mAb J58	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	F67-PE24	Anti-GPC3 mAb F67	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	I34-PE24	Anti-GPC3 mAb I34	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	I88-PE24	Anti-GPC3 mAb I88	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	R6-PE24	Anti-GPC3 mAb R6	GPC3	Pseudomonas exotoxin PE24	Undisclosed	[18]
ADC Info	LMB-12	Anti-MSLN scFv	MSLN	Pseudomonas exotoxin PE24	Undisclosed	[9]
ADC Info	LMB-164	Anti-MSLN scFv	MSLN	Pseudomonas exotoxin PE24	Undisclosed	[9]
ADC Info	hD7-1 (VL-VH)-PE24	Anti-PSMA mAb hD7-1	FOLH1	Pseudomonas exotoxin PE24	Undisclosed	[10]
ADC Info	RG7787	Anti-MSLN Anti-ody Fab fragment	MSLN	Pseudomonas exotoxin PE24	Undisclosed	[19]

Terminated in phase 1

Click To Hide/Show 1 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	LMB-7	Murine mAb B3	PARP1	Pseudomonas exotoxin PE38	Undisclosed	[20]

Terminated

Click To Hide/Show 2 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Monoclonal antibody B3-Lys-PE40 conjugate	Murine mAb B3	PARP1	LysPE40	Undisclosed	[21]
ADC Info	Monoclonal antibody C242-PE conjugate	Anti-CD138 mAb C242	MUC1	Pseudomonas exotoxin PE40	Undisclosed	[22]

References

Ref 1	Moxetumomab pasudotox in heavily pre-treated patients with relapsed/refractory hairy cell leukemia (HCL): long-term follow-up from the pivotal trial. J Hematol Oncol. 2021 Feb 24;14(1):35.
Ref 2	A phase II study of oportuzumab monatox: an immunotoxin therapy for patients with noninvasive urothelial carcinoma in situ previously treated with bacillus Calmette-Gurin. J Urol. 2012 Nov;188(5):1712-8.
Ref 3	Anti-graft-versus-host disease effect of DT390-anti-CD3sFv, a single-chain Fv fusion immunotoxin specifically targeting the CD3 epsilon moiety of the T-cell receptor. Blood. 1996 Sep 15;88(6):2342-53.
Ref 4	Recombinant immunotoxins containing anti-Tac(Fv) and derivatives of Pseudomonas exotoxin produce complete regression in mice of an interleukin-2 receptor-expressing human carcinoma. Blood. 1994 Jan 15;83(2):426-34.
Ref 5	Introduction to basic information on ADC drug Labetuzumab-PE40 conjugate; 27 Oct 2020.
Ref 6	In vivo efficacy and toxicity of a single-chain immunotoxin targeted to CD40. Blood. 1997 Jun 15;89(12):4493-500.
Ref 7	Anti-BCMA immunotoxins produce durable complete remissions in two mouse myeloma models. Proc Natl Acad Sci U S A. 2019 Mar 5;116(10):4592-4598. doi: 10.1073/pnas.1821733116. Epub 2019 Feb 19.
Ref 8	Targeted Therapy With Immunoconjugates for Multiple Myeloma. Front Immunol. 2020 Jun 19;11:1155. doi: 10.3389/fimmu.2020.01155. eCollection 2020.
Ref 9	Anti-Mesothelin Recombinant Immunotoxin Therapy for Colorectal Cancer. Clin Colorectal Cancer. 2019 Sep;18(3):192-199.e1. doi: 10.1016/j.clcc.2019.06.006. Epub 2019 Jul 2.
Ref 10	In Vitro Evaluation of Humanized/De-immunized Anti-PSMA Immunotoxins for the Treatment of Prostate Cancer. Anticancer Res. 2018 Jan;38(1):61-69. doi: 10.21873/anticanres.12192.
Ref 11	Production and Conjugation of Truncated Recombinant Diphtheria Toxin to VEGFR-2 Specific Nanobody and Evaluation of its Cytotoxic Effect on PC-3 Cell Line. Mol Biotechnol. 2022 Nov;64(11):1218-1226. doi: 10.1007/s12033-022-00485-1. Epub 2022 Apr 27.
Ref 12	Breast cancer targeted/ therapeutic with double and triple fusion Immunotoxins. J Steroid Biochem Mol Biol. 2020 Jun;200:105651. doi: 10.1016/j.jsbmb.2020.105651. Epub 2020 Mar 5.
Ref 13	Anthrax toxin receptor 2 is a potential therapeutic target for non-small cell lung carcinoma with MET exon 14 skipping mutations. Exp Cell Res. 2022 Apr 15;413(2):113078.
Ref 14	Junctional adhesion molecule 3 is a potential therapeutic target for small cell lung carcinoma. Exp Cell Res. 2023 May 15;426(2):113570. doi: 10.1016/j.yexcr.2023.113570. Epub 2023 Mar 27.
Ref 15	Humanized CD7 nanobody-based immunotoxins exhibit promising anti-T-cell acute lymphoblastic leukemia potential. Int J Nanomedicine. 2017 Mar 13;12:1969-1983. doi: 10.2147/IJN.S127575. eCollection 2017.
Ref 16	Antibody-drug conjugates with HER2-targeting antibodies from synthetic antibody libraries are highly potent against HER2-positive human gastric tumor in xenograft models. MAbs. 2019 Jan;11(1):153-165. doi: 10.1080/19420862.2018.1541370. Epub 2018 Nov 8.
Ref 17	A new therapeutic application using GRP78-specific single-chain antibody fragment (scFv) fused immnunotoxin. Cancer Res (2009) 69 (9_Supplement): 3236.
Ref 18	Highly Potent Immunotoxins Targeting the Membrane-distal N-lobe of GPC3 for Immunotherapy of Hepatocellular Carcinoma. J Cancer. 2022 Feb 14;13(4):1370-1384.
Ref 19	Anticancer Effects of Mesothelin-Targeted Immunotoxin Therapy Are Regulated by Tyrosine Kinase DDR1. Cancer Res. 2016 Mar 15;76(6):1560-8. doi: 10.1158/0008-5472.CAN-15-2401. Epub 2015 Dec 30.
Ref 20	Intrathecal administration of single-chain immunotoxin, LMB-7 [B3(Fv)-PE38], produces cures of carcinomatous meningitis in a rat model. Proc Natl Acad Sci U S A. 1995 Mar 28;92(7):2765-9. doi: 10.1073/pnas.92.7.2765.
Ref 21	Anti-tumor activities of immunotoxins made of monoclonal antibody B3 and various forms of Pseudomonas exotoxin. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3358-62. doi: 10.1073/pnas.88.8.3358.
Ref 22	Monoclonal antibody C242-Pseudomonas exotoxin A. A specific and potent immunotoxin with antitumor activity on a human colon cancer xenograft in nude mice. J Clin Invest. 1992 Aug;90(2):405-11. doi: 10.1172/JCI115875.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.

Target Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)