Antibody Information
General Information of This Antibody (ID: ANI0ENQJQ)
| Antibody Name | Anti-TNF mAb alpha-TNF |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-TNF ADC 121 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
74%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 3 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
96%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 10 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.09 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
43.7 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 129 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
76%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 3 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
85%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 10 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
0%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
3%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
73%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
86%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
7%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
9%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.04 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 126 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
92%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 3 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
100%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 10 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
3%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
32%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
73%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
88%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
35%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
71%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 131 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
96%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 3 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Paw swelling AUC |
98%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
To evaluate the impact of the anti-mTNF GRM ADCs on inflammation in a chronic inflammatory setting,we progressed several ADCs into a mouse collagen-induced arthritis (mCIA) model. A single 10 mg/kg dose of the ADC was given at the first clinical signs of disease,a time point of intervention where anti-TNF treatment has a moderate impact.
|
||||
| In Vivo Model | Collagen-induced arthritis (mCIA) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
14%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
27%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
78%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
94%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
12%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
17%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 128 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
17%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
53%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
59%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
92%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
23%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
74%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
3.9 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 134 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
25%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
58%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
72%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
94%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
36%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
74%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.8 ng/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
10.7 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 127 [Investigative]
Obtained from the Model Organism Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
34%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | P1NP inhibition |
57%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess P1NP level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
68%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Ear swelling inhibition |
94%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization.
|
||||
| In Vivo Model | Fluorescein isothiocyanate (FITC)-induced CHS model | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
0%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 3 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Corticosterone inhibition |
18%
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
In an acute in vivo model of contact hypersensitivity (CHS) mice were sensitized with fluorescein isothiocyanate (FITC) on the abdomen and challenged 6 days later with FITC on the ear,which resulted in an increase in ear swelling that was measured 24 h postchallenge. Anti-mTNF GRM ADCs were dosed at either 10 mg/kg once prior to FITC sensitization. Mice were challenged with adrenocorticotropic hormone (ACTH) 72 h following ADC dosing and plasma was collected 30 min later to assess corticosterone level.
Click to Show/Hide
|
||||
| In Vivo Model | Acute contact hypersensitivity (CHS) model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 132 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.2 ng/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
12.1 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 135 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
12 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 133 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.8 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 125 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
11.9 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 124 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 123 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 120 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
8.5 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 119 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
50 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 115 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
1.4 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 104 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.77 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 130 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.09 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
36.8 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 114 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.12 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 109 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.12 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 108 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.16 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
4.7 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 110 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.19 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.9 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 113 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.2 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
3.1 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 116 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.29 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
5.8 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 112 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.38 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
6.4 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 106 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.45 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
3.4 ug/mL
|
Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 118 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
0.55 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 111 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
1.08 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 117 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.18 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 105 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.18 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells (TNF expression) | CVCL_0004 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
Anti-TNF ADC 107 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
7.03 ug/mL
|
Positive TNF expression (TNF+++/++) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells (Multidrug resistance) | CVCL_2481 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50 ug/mL | Negative TNF expression (TNF-) | ||
| Method Description |
All the DAR purified ADCs were screened in both the TNF-expressing and wild-type K562 GRE reporter cell assay to confirm that their activity was consistent with ADCs having heterogeneous average DAR.
|
||||
| In Vitro Model | Chronic myelogenous leukemia | K-562 cells | CVCL_0004 | ||
References
