General Information of This Antigen
Antigen ID
TAR0DEDPZ
Antigen Name
Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A)
Gene Name
TNFRSF1A
Gene ID
7132
Synonym
TNFAR; TNFR1; Tumor necrosis factor receptor 1;Tumor necrosis factor receptor type I;p55;p60;CD_antigen=CD120a
Sequence
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

    Click to Show/Hide
Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

    Click to Show/Hide
Uniprot Entry
TNR1A_HUMAN
HGNC ID
HGNC:11916
KEGG ID
hsa:7132
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-TNF mAb 8c11
ADC Info ADC Name Payload Target Linker Ref
WO2022171101A1 ADC-47
WO2022171101A1 ADC-47 payload
Undisclosed
WO2022171101A1 ADC-47 linker
[1]
WO2022171101A1 ADC-49
WO2022171101A1 ADC-49 payload
Undisclosed
WO2022171101A1 ADC-49 linker
[1]
WO2023025248A1 ADC-50
WO2023025248A1 ADC-50 payload
Undisclosed
WO2023025248A1 ADC-50 linker
[2]
WO2023025248A1 ADC-51
WO2023025248A1 ADC-51 payload
Undisclosed
WO2023025248A1 ADC-51 linker
[2]
WO2023025248A1 ADC-52
WO2023025248A1 ADC-52 payload
Undisclosed
WO2023025248A1 ADC-52 linker
[2]
WO2023025248A1 ADC-53
WO2023025248A1 ADC-53 payload
Undisclosed
WO2023025248A1 ADC-53 linker
[2]
WO2023025248A1 ADC-54
WO2023025248A1 ADC-54 payload
Undisclosed
WO2023025248A1 ADC-54 linker
[2]
WO2023025248A1 ADC-55
WO2023025248A1 ADC-55 payload
Undisclosed
WO2023025248A1 ADC-55 linker
[2]
Anti-TNF mAb alpha-TNF
ADC Info ADC Name Payload Target Linker Ref
ABBV-3373
GRM cpd 17
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[3]
Anti-TNF ADC 104
GRM cpd 5
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 105
GRM cpd 16
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 106
GRM cpd 17
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 107
GRM cpd 18
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 108
GRM cpd 19
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 109
GRM cpd 20
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 110
GRM cpd 22
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 111
GRM cpd 23
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 112
GRM cpd 24
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 113
GRM cpd 25
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 114
GRM cpd 26
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 115
GRM cpd 30
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 116
GRM cpd 31
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 117
GRM cpd 33
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 118
GRM cpd 61
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 119
GRM cpd 5
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 120
GRM cpd 5
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 121
GRM cpd 17
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 123
GRM cpd 19
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 124
GRM cpd 19
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 125
GRM cpd 20
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 126
GRM cpd 20
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 127
GRM cpd 25
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 128
GRM cpd 26
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 129
GRM cpd 30
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 130
GRM cpd 31
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 131
GRM cpd 31
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 132
GRM cpd 32
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 133
GRM cpd 32
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 134
GRM cpd 64
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF ADC 135
GRM cpd 63
Glucocorticoid receptor (NR3C1)
MP-Ala-Ala
[4]
Anti-TNF mAb B-II-B059
ADC Info ADC Name Payload Target Linker Ref
WO2022171101A1 ADC-46
WO2022171101A1 ADC-46 payload
Undisclosed
WO2022171101A1 ADC-46 linker
[1]
ADC Info ADC Name Payload Target Linker Ref
WO2022135332A1 1-12
WO2022135332A1_1-12 payload
Undisclosed
WO2022135332A1_1-12 linker
[5]
WO2023025248A1 ADC-58
WO2023025248A1 ADC-58 payload
Undisclosed
WO2023025248A1 ADC-58 linker
[2]
WO2023025248A1 ADC-59
WO2023025248A1 ADC-59 payload
Undisclosed
WO2023025248A1 ADC-59 linker
[2]
WO2023025248A1 ADC-60
WO2023025248A1 ADC-60 payload
Undisclosed
WO2023025248A1 ADC-60 linker
[2]
Iscalimab
ADC Info ADC Name Payload Target Linker Ref
WO2023025248A1 ADC-57
WO2023025248A1 ADC-57 payload
Undisclosed
WO2023025248A1 ADC-57 linker
[2]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
DB-2306
Undisclosed
Undisclosed
Undisclosed
[6]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.14811611; Fold-change: 0.047880615; Z-score: 0.151664329
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042630745; Fold-change: -0.484597105; Z-score: -3.050688081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01048246; Fold-change: -0.112645548; Z-score: -0.333369085
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00362344; Fold-change: -0.733975531; Z-score: -1.443145012
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.20E-67; Fold-change: 1.066715197; Z-score: 1.524245772
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.32E-05; Fold-change: 0.177496209; Z-score: 0.559841743
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00416731; Fold-change: -0.24405421; Z-score: -0.75279697
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002899161; Fold-change: 0.204567919; Z-score: 0.468018048
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.106628114; Fold-change: 1.320202543; Z-score: 1.32941795
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.914933233; Fold-change: -0.012299553; Z-score: -0.049773099
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.586213624; Fold-change: 0.525449047; Z-score: 0.760179243
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002606127; Fold-change: 0.45466692; Z-score: 1.310512942
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.82E-49; Fold-change: -0.486765321; Z-score: -1.552182406
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.47E-18; Fold-change: -0.331650086; Z-score: -0.859118072
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.441352437; Fold-change: 0.352853393; Z-score: 0.441510248
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.02E-06; Fold-change: 0.749251934; Z-score: 0.911479533
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.45E-07; Fold-change: -0.427978811; Z-score: -1.034678765
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.10E-33; Fold-change: -0.526669484; Z-score: -1.266333069
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.044142156; Fold-change: -0.681588807; Z-score: -1.347481086
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.68E-15; Fold-change: -0.228529432; Z-score: -0.7129685
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.85E-30; Fold-change: -0.500126255; Z-score: -1.206810823
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.474791797; Fold-change: 0.033221522; Z-score: 0.064855331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.40E-136; Fold-change: 1.112024843; Z-score: 2.113295072
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006252395; Fold-change: 0.986885457; Z-score: 3.109483034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.27E-19; Fold-change: -0.305159689; Z-score: -0.686026556
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.814993234; Fold-change: -0.057028684; Z-score: -0.090445512
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.716272492; Fold-change: 0.171999597; Z-score: 0.227938556
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.451923011; Fold-change: 0.011267797; Z-score: 0.034245682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.515068935; Fold-change: -0.131908906; Z-score: -0.301694594
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.07E-06; Fold-change: -0.170163987; Z-score: -0.264337084
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.054666292; Fold-change: 0.494387655; Z-score: 1.010194015
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.063478614; Fold-change: -0.312512512; Z-score: -0.472150983
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.408786444; Fold-change: 0.106476592; Z-score: 0.45379692
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.79E-13; Fold-change: 2.786739391; Z-score: 8.335911379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.36E-38; Fold-change: 0.716905234; Z-score: 2.432688964
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.88E-16; Fold-change: 0.986210945; Z-score: 2.149915133
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.001130596; Fold-change: -0.334424633; Z-score: -1.124741265
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.15E-28; Fold-change: 0.705480495; Z-score: 1.937157873
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.46E-05; Fold-change: -1.061483432; Z-score: -1.852021905
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000491061; Fold-change: -0.391519193; Z-score: -0.716583326
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.815908145; Fold-change: 0.062592346; Z-score: 0.078917283
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.05556023; Fold-change: 0.229096884; Z-score: 0.178235417
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042136337; Fold-change: 0.410125625; Z-score: 0.61262029
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.778641202; Fold-change: 0.042102353; Z-score: 0.136902284
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.086403499; Fold-change: 0.344982906; Z-score: 0.665549641
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.353214634; Fold-change: 0.200512986; Z-score: 1.028965356
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.91743123; Fold-change: 0.078650891; Z-score: 0.57683014
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.093196395; Fold-change: -0.755284679; Z-score: -1.435163983
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000196969; Fold-change: 0.22877351; Z-score: 0.984928502
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.204810538; Fold-change: -0.260048106; Z-score: -0.364439376
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.151107949; Fold-change: 0.361177204; Z-score: 0.758963249
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003978903; Fold-change: -1.724911027; Z-score: -11.77435437
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.103474706; Fold-change: -0.519573735; Z-score: -1.658842209
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011497627; Fold-change: 0.268912522; Z-score: 0.300663381
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.15E-18; Fold-change: 0.693812635; Z-score: 0.965832081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000346534; Fold-change: 0.793550846; Z-score: 1.693033024
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.357720645; Fold-change: -0.359950654; Z-score: -4.670924137
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.981811397; Fold-change: -0.125897723; Z-score: -0.162497099
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000163969; Fold-change: 0.85902319; Z-score: 7.520569431
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.782751253; Fold-change: 0.053614325; Z-score: 0.061275552
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.620481092; Fold-change: 0.084824511; Z-score: 0.318974918
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005560048; Fold-change: 0.485801419; Z-score: 1.359035102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.511109428; Fold-change: -0.136252238; Z-score: -0.517874404
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.893679149; Fold-change: -0.356654611; Z-score: -1.051826434
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.260605763; Fold-change: 0.123872566; Z-score: 0.317955834
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.670425022; Fold-change: -0.014532836; Z-score: -0.070131901
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.117318992; Fold-change: -0.150811952; Z-score: -0.299698211
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.328436415; Fold-change: 0.091971816; Z-score: 0.240920886
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.138838415; Fold-change: 0.105637117; Z-score: 0.296091656
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.487219875; Fold-change: 0.021456854; Z-score: 0.078777032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.25476147; Fold-change: -0.193934335; Z-score: -0.371523213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.288496317; Fold-change: 0.056056538; Z-score: 0.179904479
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.307063077; Fold-change: 0.358477656; Z-score: 1.356589607
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001106199; Fold-change: -0.709731023; Z-score: -1.721169644
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.093421392; Fold-change: 0.120761728; Z-score: 0.199835897
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.710921787; Fold-change: -0.017181193; Z-score: -0.074506359
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.30E-09; Fold-change: 0.471941368; Z-score: 1.702161563
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.810359909; Fold-change: -0.023889936; Z-score: -0.072763597
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.37E-06; Fold-change: 0.177579144; Z-score: 0.69692906
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.2075701; Fold-change: 0.119418424; Z-score: 0.695450374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.067288701; Fold-change: 0.080620588; Z-score: 0.373666421
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.435575017; Fold-change: 0.101654195; Z-score: 0.730841775
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.326161901; Fold-change: 0.598644999; Z-score: 0.462267807
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.086330648; Fold-change: 0.132913617; Z-score: 0.405407683
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.683794081; Fold-change: 0.038955302; Z-score: 0.041294216
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000386959; Fold-change: 1.402249872; Z-score: 2.548657264
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.187668375; Fold-change: 0.060164534; Z-score: 0.224587871
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.066712662; Fold-change: 0.148963479; Z-score: 2.01819718
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.49E-07; Fold-change: 0.45816375; Z-score: 1.30282461
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.155953504; Fold-change: 0.263014466; Z-score: 0.810264786
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.511870556; Fold-change: -0.007347457; Z-score: -0.01776036
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.40E-06; Fold-change: 0.341778191; Z-score: 0.611779876
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.495638961; Fold-change: 0.052191231; Z-score: 0.079943597
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.263292216; Fold-change: -0.166811163; Z-score: -0.654060459
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.020579002; Fold-change: 0.438562885; Z-score: 0.790693767
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000358458; Fold-change: 0.35242164; Z-score: 0.753981778
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.551584413; Fold-change: 0.183714941; Z-score: 0.693402217
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000196375; Fold-change: -0.209282095; Z-score: -2.254322985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.530873347; Fold-change: -0.059152323; Z-score: -0.295194868
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.88E-08; Fold-change: -0.262431158; Z-score: -0.780846396
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00022846; Fold-change: -0.16596218; Z-score: -0.576686848
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007340324; Fold-change: 0.814647993; Z-score: 1.959264983
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.53E-10; Fold-change: 0.742100341; Z-score: 1.610833071
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.799653982; Fold-change: 0.127083034; Z-score: 0.141099993
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.735301845; Fold-change: 0.166451706; Z-score: 0.40892545
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006319114; Fold-change: 1.584422409; Z-score: 25.27439157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.354405832; Fold-change: 0.361511228; Z-score: 0.82014903
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037341761; Fold-change: -0.051031715; Z-score: -0.191787123
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.792042125; Fold-change: 0.003117525; Z-score: 0.009786211
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.068204689; Fold-change: 0.132645973; Z-score: 0.434299973
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.26418191; Fold-change: 0.123951633; Z-score: 0.628998235
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.096945101; Fold-change: -0.288933832; Z-score: -1.046277655
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.885836891; Fold-change: -0.079001514; Z-score: -0.172228747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001805864; Fold-change: -1.355582929; Z-score: -2.002174937
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.998258061; Fold-change: 0.171421865; Z-score: 0.507878681
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.442535066; Fold-change: 0.098376819; Z-score: 0.447692115
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.069911437; Fold-change: 0.136719816; Z-score: 0.556866985
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.61E-06; Fold-change: 1.005202455; Z-score: 2.994950012
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.921572664; Fold-change: -0.079112271; Z-score: -0.36291543
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310726974; Fold-change: 0.085656327; Z-score: 0.201052667
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033031452; Fold-change: 0.116864185; Z-score: 0.530216175
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.071178053; Fold-change: 0.247258966; Z-score: 0.450500913
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.572944413; Fold-change: 0.012613753; Z-score: 0.022477224
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.17E-08; Fold-change: 0.434403012; Z-score: 0.728346623
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.899686861; Fold-change: 0.105834149; Z-score: 0.166043817
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.366546187; Fold-change: -0.06860933; Z-score: -0.544976824
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001551658; Fold-change: 0.976817945; Z-score: 2.821219396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001960389; Fold-change: 0.588051791; Z-score: 1.470971624
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.548596078; Fold-change: 0.40870303; Z-score: 0.500334194
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Steroid conjugate; 2022-08-18.
Ref 2 Steroid compound and conjugate thereof; 2023-03-02.
Ref 3 Efficacy and Safety of ABBV-3373, a Novel Anti-Tumor Necrosis Factor Glucocorticoid Receptor Modulator Antibody-Drug Conjugate, in Adults with Moderate-to-Severe Rheumatoid Arthritis Despite Methotrexate Therapy: A Randomized, Double-Blind, Active-Controlled Proof-of-Concept Phase IIa Trial. Arthritis Rheumatol. 2023 Jun;75(6):879-889.
Ref 4 Discovery of ABBV-3373, an Anti-TNF Glucocorticoid Receptor Modulator Immunology Antibody Drug Conjugate. J Med Chem. 2022 Dec 8;65(23):15893-15934.
Ref 5 Steroid conjugate; 2022-06-30.
Ref 6 DB-2306, a Novel Anti-TNFalpha Monoclonal Antibody Drug Conjugate, Is a Promising Novel Therapeutic Approach for Autoimmune Disease. Arthritis Rheumatol. 2022; 74 (suppl 9).