Antigen Information
General Information of This Antigen
| Antigen ID | TAR0SDULL |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Mast/stem cell growth factor receptor Kit (KIT) |
|||||
| Gene Name | KIT |
|||||
| Gene ID | ||||||
| Synonym | SCFR; Piebald trait protein;Proto-oncogene c-Kit;Tyrosine-protein kinase Kit;p145 c-kit;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;CD_antigen=CD117 |
|||||
| Sequence |
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV GSTASSSQPLLVHDDV Click to Show/Hide
|
|||||
| Family | Tyr protein family |
|||||
| Function |
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5- trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-cKIT F (ab')<sub>2</sub>
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J12 |
TWI852077B-C4-payload |
Microtubule (MT) |
TWI852077B-C4-linker |
[1] |
Anti-cKIT F (ab'3)<sub>2</sub>
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J10 |
Undisclosed |
Undisclosed |
Undisclosed |
[1] |
Anti-cKIT F (ab'4)<sub>2</sub>
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J9 |
TWI852077B-C4-payload |
Microtubule (MT) |
TWI852077B-C4-linker |
[1] |
Anti-cKIT Fab'1
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J1 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J14 |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] | |
TWI852077B-J15 |
Undisclosed |
Undisclosed |
Undisclosed |
[1] | |
TWI852077B-J16 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] |
Anti-cKIT Fab'2
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J2 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J17 |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] | |
TWI852077B-J18 |
Undisclosed |
Undisclosed |
Undisclosed |
[1] | |
TWI852077B-J19 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-JW |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852078B-JX |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-cKIT Fab'3
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J3 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J20 |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] | |
TWI852077B-J21 |
Undisclosed |
Undisclosed |
Undisclosed |
[1] | |
TWI852077B-J22 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852079B-JY |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852080B-JZ |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-cKIT Fab'4
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J4 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] |
Anti-cKIT Fab'5
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J5 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J23 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J24 |
Monomethyl auristatin E |
Microtubule (MT) |
TWI852077B-C1-linker |
[1] | |
TWI852077B-J25 |
Monomethyl auristatin F |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-cKIT Fab3
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
TWI852077B-J7 |
Undisclosed |
Undisclosed |
Undisclosed |
[1] | |
TWI852077B-J11 |
TWI852077B-C4-payload |
Microtubule (MT) |
TWI852077B-C4-linker |
[1] |
Anti-KIT mAb 20376
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT 20376-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT 20376-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT 20376-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT 20376-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT 20376-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT 20376-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT 20376 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb 2G4
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
2G4-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Undisclosed |
[3] |
Anti-KIT mAb 4C9
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
4C9-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[4] |
Anti-KIT mAb 9P3
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT 9P3-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT 9P3-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT 9P3-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT 9P3-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT 9P3-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT 9P3-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT 9P3 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG024
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG024-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG024-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG024-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG024-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG024-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG024-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG024 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG026
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG026-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG026-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG026-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG026-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG026-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG026-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG026 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG027
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG027-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG027-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG027-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG027-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG027-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG027-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG027 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG085
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG085-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG085-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG085-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG085-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG085-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG085-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG085 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG086
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG086-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG086-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG086-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG086-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG086-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG086-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG086 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
Anti-KIT mAb NEG087
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-KIT NEG087-SMCC-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] | |
Anti-KIT NEG087-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[2] | |
Anti-KIT NEG087-CX1-1-DM1 |
Mertansine DM1 |
Microtubule (MT) |
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1) |
[2] | |
Anti-KIT NEG087-SSNPP-DM3 |
Maytansinoid DM3 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[2] | |
Anti-KIT NEG087-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] | |
Anti-KIT NEG087-SPDP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
[2] | |
Anti-KIT NEG087 Sulfo-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfo-SPDB |
[2] |
LMJ729
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
LOP628 |
DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
NN2101
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
NN3201 |
MMAE |
Microtubule (MT) |
Bis-sulfone-(PEG24)-Glu-Val-Cit-PAB |
||
NN2101-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[5] |
Opelkibart
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
opelkibart elmanitin |
α-amanitin |
RNA polymerase II |
Undisclosed |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
NN-3901 |
Undisclosed |
Undisclosed |
Undisclosed |
[6] | |
NN-3202 |
Undisclosed |
Undisclosed |
Undisclosed |
[7] | |
C-Kit Antibody-drug conjugate (Novartis/ImmunoGen) |
Undisclosed |
Undisclosed |
Undisclosed |
[8] | |
KTN0182A |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Undisclosed |
[9] | |
WO2024121632A1Formula la |
Undisclosed |
Undisclosed |
Undisclosed |
[11] |
undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CD117-ADC |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala-PABC |
[10] |
References
