General Information of This Antigen
Antigen ID
TAR0SDULL
Antigen Name
Mast/stem cell growth factor receptor Kit (KIT)
Gene Name
KIT
Gene ID
3815
Synonym
SCFR; Piebald trait protein;Proto-oncogene c-Kit;Tyrosine-protein kinase Kit;p145 c-kit;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;CD_antigen=CD117
Sequence
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV

    Click to Show/Hide
Family
Tyr protein family
Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5- trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.

    Click to Show/Hide
Uniprot Entry
KIT_HUMAN
HGNC ID
HGNC:6342
KEGG ID
hsa:3815
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-KIT mAb 20376
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT 20376 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT 20376?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT 20376?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT 20376?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT 20376?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT 20376?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT 20376?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb 2G4
ADC Info ADC Name Payload Target Linker Ref
2G4-DM1
Mertansine DM1
Microtubule (MT)
Undisclosed
[2]
Anti-KIT mAb 4C9
ADC Info ADC Name Payload Target Linker Ref
4C9-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[3]
Anti-KIT mAb 9P3
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT 9P3 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT 9P3?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT 9P3?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT 9P3?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT 9P3?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT 9P3?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT 9P3?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG024
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG024 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG024?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG024?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG024?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG024?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG024?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG024?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG026
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG026 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG026?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG026?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG026?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG026?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG026?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG026?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG027
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG027 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG027?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG027?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG027?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG027?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG027?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG027?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG085
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG085 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG085?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG085?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG085?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG085?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG085?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG085?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG086
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG086 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG086?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG086?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG086?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG086?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG086?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG086?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
Anti-KIT mAb NEG087
ADC Info ADC Name Payload Target Linker Ref
Anti-KIT NEG087 Sulfo-SPDB-DM4
Mertansine DM4
Microtubule (MT)
Sulfo-SPDB
[1]
Anti-KIT NEG087?CX1-1-DM1
Mertansine DM1
Microtubule (MT)
2,5-Dioxopyrrolidin-1-yl 17-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-5,8,11,14-tetraazaheptadecan-1-oate (CX1-1)
[1]
Anti-KIT NEG087?SMCC-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[1]
Anti-KIT NEG087?SPDB-DM4
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[1]
Anti-KIT NEG087?SPDP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP)
[1]
Anti-KIT NEG087?SPP-DM1
Mertansine DM1
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP)
[1]
Anti-KIT NEG087?SSNPP-DM3
Maytansinoid DM3
Microtubule (MT)
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP)
[1]
humanized Anti-KIT mAb LMJ729
ADC Info ADC Name Payload Target Linker Ref
LOP-628
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[4]
ADC Info ADC Name Payload Target Linker Ref
NN-3201
Monomethyl auristatin E
Microtubule (MT)
Site-specific, cleavable peptide linker
[5]
NN2101-DM1
Mertansine DM1
Microtubule (MT)
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC)
[6]
Opelkibart
ADC Info ADC Name Payload Target Linker Ref
MGTA-117
Alpha-amanitin
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Undisclosed
[7]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
C-Kit Antibody-drug conjugate (Novartis/ImmunoGen)
Undisclosed
Undisclosed
Undisclosed
[8]
KTN0182A
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Undisclosed
[9]
NN-3202
Undisclosed
Undisclosed
Undisclosed
[10]
NN-3901
Undisclosed
Undisclosed
Undisclosed
[11]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000344731; Fold-change: 0.211482308; Z-score: 0.367817365
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.72887957; Fold-change: 0.213378889; Z-score: 0.530486173
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.047224156; Fold-change: -0.940432875; Z-score: -0.789218709
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.429263317; Fold-change: -0.170673514; Z-score: -0.377429833
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.84E-72; Fold-change: -1.13508409; Z-score: -1.287349069
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224508021; Fold-change: 0.026607597; Z-score: 0.099425028
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.054525215; Fold-change: 0.443194228; Z-score: 1.6235926
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010103927; Fold-change: 0.117150592; Z-score: 0.368380128
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.005805415; Fold-change: 5.262108367; Z-score: 3.689083614
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.248691347; Fold-change: -0.138311679; Z-score: -0.383043873
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000370484; Fold-change: -1.169359596; Z-score: -7.366186716
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.12E-05; Fold-change: -1.523744743; Z-score: -1.840600586
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.13E-59; Fold-change: -1.51022591; Z-score: -2.323096141
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.74E-35; Fold-change: -1.469093073; Z-score: -1.829287901
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.647404073; Fold-change: -0.167161638; Z-score: -0.205938038
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.412160289; Fold-change: 0.272046294; Z-score: 0.234894818
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.44E-05; Fold-change: 0.248496397; Z-score: 0.489242179
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.014275578; Fold-change: 0.15076112; Z-score: 0.216113033
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.286131954; Fold-change: 0.326971432; Z-score: 0.534341153
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.26E-22; Fold-change: -0.776498493; Z-score: -1.332576539
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.80E-18; Fold-change: -0.905193797; Z-score: -1.193957206
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.092123372; Fold-change: -0.451422661; Z-score: -0.367729939
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.57E-99; Fold-change: 1.967108579; Z-score: 3.022054233
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002201573; Fold-change: 1.999241593; Z-score: 3.915072013
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.89E-108; Fold-change: -2.831217553; Z-score: -2.29770917
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.46E-14; Fold-change: -2.628606953; Z-score: -1.770109347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000350267; Fold-change: -2.869313094; Z-score: -1.968366046
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.587449933; Fold-change: 0.083281963; Z-score: 0.083218255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.032372314; Fold-change: -0.308642038; Z-score: -0.452144909
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.102086751; Fold-change: -0.217900926; Z-score: -0.284976531
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.32224335; Fold-change: 0.248969687; Z-score: 0.402639025
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.197646378; Fold-change: -0.135486108; Z-score: -0.09649356
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.31E-11; Fold-change: -2.923427819; Z-score: -8.320199219
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.52E-10; Fold-change: 4.69330647; Z-score: 10.19377117
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.35E-88; Fold-change: -3.469940221; Z-score: -5.348001365
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.89E-52; Fold-change: -3.043816058; Z-score: -5.968908197
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 1.85E-09; Fold-change: 0.697194908; Z-score: 2.030850402
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.26E-09; Fold-change: -0.442415181; Z-score: -0.753930976
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007536893; Fold-change: -0.910019056; Z-score: -0.710071815
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.048379179; Fold-change: -0.732487376; Z-score: -0.62045413
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.478933976; Fold-change: 0.43235613; Z-score: 0.742001788
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002694376; Fold-change: -0.274084011; Z-score: -0.370636691
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.352676804; Fold-change: 0.053781634; Z-score: 0.149909157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.701319982; Fold-change: 0.038861486; Z-score: 0.154182747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.634418194; Fold-change: -0.193417642; Z-score: -0.339390975
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.114062356; Fold-change: 1.33178626; Z-score: 1.839024303
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.433218786; Fold-change: -0.485704148; Z-score: -0.743852893
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.559135298; Fold-change: 0.529697984; Z-score: 0.706784274
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.047128941; Fold-change: 0.044532805; Z-score: 0.060849754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.885314702; Fold-change: 0.01106775; Z-score: 0.036746404
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.139775636; Fold-change: -0.345624965; Z-score: -0.607613564
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00013432; Fold-change: 1.044084476; Z-score: 5.836840882
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.337098154; Fold-change: -0.372996883; Z-score: -0.375123508
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002313756; Fold-change: -0.159171364; Z-score: -0.414991669
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.67E-36; Fold-change: -0.536647875; Z-score: -1.435069808
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.645901105; Fold-change: -0.152616928; Z-score: -0.540095432
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.916668641; Fold-change: -0.235670265; Z-score: -1.25796745
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000548207; Fold-change: -0.904435836; Z-score: -0.808626565
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005165846; Fold-change: 1.571555233; Z-score: 2.296074926
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.103357038; Fold-change: 0.673673001; Z-score: 1.024419008
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.175861596; Fold-change: 0.200355385; Z-score: 0.650997104
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002225208; Fold-change: 1.307819681; Z-score: 1.010772407
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003097602; Fold-change: -0.283275188; Z-score: -1.24159938
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022382872; Fold-change: 0.610243065; Z-score: 1.210228116
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.970577884; Fold-change: 0.085527497; Z-score: 0.144270026
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.250806346; Fold-change: -0.450916633; Z-score: -0.514325242
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006313925; Fold-change: -0.340320987; Z-score: -0.653204408
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.493469724; Fold-change: -0.010757989; Z-score: -0.013098584
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.02E-11; Fold-change: 1.117450363; Z-score: 0.829154742
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.297123309; Fold-change: 0.051729318; Z-score: 0.110041226
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.377621312; Fold-change: 0.59468014; Z-score: 0.685050017
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.094040179; Fold-change: 0.110392146; Z-score: 0.189078033
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.700815433; Fold-change: -0.181265549; Z-score: -0.230998114
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.383464114; Fold-change: 0.205219379; Z-score: 0.369119197
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.071445162; Fold-change: 0.428096491; Z-score: 0.383918923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.587820728; Fold-change: -0.118417968; Z-score: -0.207128054
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000178967; Fold-change: -0.463950279; Z-score: -1.609097536
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.09E-26; Fold-change: -0.778008377; Z-score: -2.006274025
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.03E-11; Fold-change: -0.418718061; Z-score: -1.339743394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031687105; Fold-change: -0.069742516; Z-score: -0.271565286
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003543242; Fold-change: 0.234273618; Z-score: 0.622780961
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.26569503; Fold-change: -0.188194645; Z-score: -1.228759888
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.313380807; Fold-change: -0.002599704; Z-score: -0.002693224
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.640945479; Fold-change: -0.005703727; Z-score: -0.01372749
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.457176437; Fold-change: -0.015147817; Z-score: -0.035983474
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005646877; Fold-change: -0.292866957; Z-score: -0.525716769
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.887638596; Fold-change: 0.006402094; Z-score: 0.0378318
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127241628; Fold-change: 0.444019706; Z-score: 0.89274715
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.256090831; Fold-change: -0.467178977; Z-score: -0.694700884
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.232762423; Fold-change: -0.443759738; Z-score: -1.303881803
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.243674972; Fold-change: 0.256806943; Z-score: 0.964678266
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.88E-36; Fold-change: 1.646611263; Z-score: 2.116907548
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.09E-16; Fold-change: 2.276505671; Z-score: 11.88849533
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.885604552; Fold-change: -0.092854006; Z-score: -0.113008728
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.14833479; Fold-change: -0.076774099; Z-score: -0.082996483
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.20E-06; Fold-change: -0.409523564; Z-score: -0.618661689
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.042524804; Fold-change: -1.598546124; Z-score: -1.33699054
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.00E-05; Fold-change: -1.488595057; Z-score: -3.601346281
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.04E-06; Fold-change: -1.157248766; Z-score: -4.477120047
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.48E-39; Fold-change: -1.484343174; Z-score: -2.965127249
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.18E-35; Fold-change: -1.271086543; Z-score: -2.987819396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.94E-06; Fold-change: -1.174205264; Z-score: -2.772109342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.82E-13; Fold-change: -0.868546797; Z-score: -1.396241193
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.495549472; Fold-change: -0.187710182; Z-score: -0.300922473
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.20365365; Fold-change: 0.298767211; Z-score: 0.683371344
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.279219479; Fold-change: -0.056207306; Z-score: -0.202255297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001116284; Fold-change: -0.844860855; Z-score: -1.741147524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.122020715; Fold-change: -0.007781788; Z-score: -0.048512923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.55389445; Fold-change: 0.071385938; Z-score: 0.270359794
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.36965906; Fold-change: 0.010703172; Z-score: 0.024631267
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113653412; Fold-change: 0.614048802; Z-score: 2.265321237
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002912359; Fold-change: 0.611996633; Z-score: 4.816794433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00814617; Fold-change: -0.470518898; Z-score: -1.275364422
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001653196; Fold-change: -1.126556325; Z-score: -1.409544315
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.316127654; Fold-change: -0.056777909; Z-score: -0.262291275
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.374343793; Fold-change: 0.035234136; Z-score: 0.282647313
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.959004284; Fold-change: -0.113576871; Z-score: -0.25237084
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.731157492; Fold-change: 0.128922403; Z-score: 0.305088333
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.238190443; Fold-change: 0.008370341; Z-score: 0.018599627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.135587136; Fold-change: 0.139703178; Z-score: 0.49890354
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.298210046; Fold-change: 0.019446422; Z-score: 0.032359043
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037156379; Fold-change: 0.943603615; Z-score: 0.854102041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.656492975; Fold-change: 0.041922083; Z-score: 0.244828795
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.205582054; Fold-change: -0.098317698; Z-score: -0.142214787
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043044612; Fold-change: -0.155559031; Z-score: -0.564945826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.633054329; Fold-change: 0.023721826; Z-score: 0.019726789
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.111330058; Fold-change: 0.104359164; Z-score: 0.406367367
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.12E-06; Fold-change: 1.394552739; Z-score: 2.12980547
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039333221; Fold-change: 0.675275782; Z-score: 0.864266674
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Antibody drug conjugates.
Ref 2 Antibody-immunotoxin Conjugate Using FcBP-mediated Photoconjugation to Treat Cancer. Anticancer Res. 2022 Jul;42(7):3453-3461. doi: 10.21873/anticanres.15832.
Ref 3 Antibody-Drug Conjugate Targeting c-Kit for the Treatment of Small Cell Lung Cancer. Int J Mol Sci. 2022 Feb 18;23(4):2264.
Ref 4 Preclinical Antitumor Activity of a Novel Anti-c-KIT Antibody-Drug Conjugate against Mutant and Wild-type c-KIT-Positive Solid Tumors. Clin Cancer Res. 2018 Sep 1;24(17):4297-4308. doi: 10.1158/1078-0432.CCR-17-3795. Epub 2018 May 15.
Ref 5 An optimized preclinical antibody-drug conjugate against cancers with cKIT overexpression or activating mutations. Cancer Res (2022) 82 (12_Supplement): 6227.
Ref 6 A novel anti-c-Kit antibody-drug conjugate to treat wild-type and activating-mutant c-Kit-positive tumors. Mol Oncol. 2022 Mar;16(6):1290-1308.
Ref 7 TIP: A phase I/II study of MGTA-117, an anti-CD117 antibody-drug conjugate, in patients with adult acute myeloid leukemia (AML) and myelodysplasia with excess blasts (MDS-EB). Journal of Clinical Oncology 40, no. 16_suppl (June 01, 2022) TPS3156-TPS3156.
Ref 8 Introduction to basic information on ADC drug C-Kit Antibody-drug conjugate (Novartis/ImmunoGen)
Ref 9 ADC review: basic information about KTN0182A.
Ref 10 Introduction to basic information on ADC drug NN-3202.
Ref 11 Novelty nobility attracts $9M in series a funding for NN2101 GLP tox studies; 2020