General Information of This Antibody (ID: ANI0QYT002)
Antibody Name
Opelkibart
Organization
Heidelberg Pharma AG
Synonyms
Opelkibart
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Mast/stem cell growth factor receptor Kit (KIT)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTNYWIGWVRQMPGKGLEWMAIINPRDSDTRY
RPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARHGRGYEGYEGAFDIWGQGTLVT
VSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRSSQGIRSDLGWYQQKPGKAPKLLIYDASNLETGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQANGFPLTFGGGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
opelkibart elmanitin [Phase 1/2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Key inclusion: WHO-defined R/R AML/MDS-EB patients (treatment failure/refractory or MRD+ in CR); CD117+ confirmed; identified HSC donor; ECOG ≤2; adequate hepatic/renal/cardiac function (ALT/AST/ALP ≤2xULN, bilirubin ≤1.5xULN, CrCl ≥60mL/min, LVEF ≥40% or NYHA I-II).
Administration Dosage
MGTA-117 will be administered as an IV infusion
Related Clinical Trial
NCT Number NCT05223699  Clinical Status PHASE1
Clinical Description
A Phase I/II, Dose-Escalation Study of MGTA-117 in Patients With Adult Acute Myeloid Leukemia (AML) and Myelodysplasia-Excess Blasts (MDS-EB)
Primary Endpoint
Primary endpoints include TEAE-related discontinuation rate, ≥Grade 3 lab abnormalities (CTCAE v5.0), vital signs/ECG/lab parameter changes, MGTA-117 PK profile (AUC/Cmax/Tmax/t1/2/plasma concentration), and minimum safe/effective dose (CD117 receptor occupancy at Day 7 and DLT incidence at Day 21), all assessed within 21 days.
References
Ref 1 Study of MGTA-117 in Patients With Adult Acute Myeloid Leukemia (AML) and Myelodysplasia-Excess Blasts (MDS-EB)