Antibody Information
General Information of This Antibody (ID: ANI0IZYHP)
| Antibody Name | Anti-KIT mAb 9P3 |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Mast/stem cell growth factor receptor Kit (KIT) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQAPGKGLEWVANINYDGSSTYY
LDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGDYYGTTYWYFDVWGQGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYYTSRLQSGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQQGKKLWSFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-KIT 9P3-SPDB-DM4 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 31.88% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (1 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | Kasumi-1 CDX model | ||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 91.94% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | HMC-1 CDX model | ||||
| In Vitro Model | Mast cell leukemia | HMC-1 cells | CVCL_0003 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (2.5 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST-T1 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST430 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.09% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | Kasumi-1 CDX model | ||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST-T1 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
65%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
75%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
84%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H889 cells | CVCL_1598 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
88%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1930 cells | CVCL_1507 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
92%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
94%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
94%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
98%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H526 cells | CVCL_1569 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | M-07e cells | CVCL_2106 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Essential thrombocythemia | UKE-1 cells | CVCL_0104 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.05 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.07 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.11 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | M-07e cells | CVCL_2106 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.13 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.17 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H526 cells | CVCL_1569 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.17 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.3 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1930 cells | CVCL_1507 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.83 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 23 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.91 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 24 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.26 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 25 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.47 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H889 cells | CVCL_1598 | ||
| Experiment 26 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.6 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 27 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
2.77 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
| Experiment 28 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
5.6 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Essential thrombocythemia | UKE-1 cells | CVCL_0104 | ||
Anti-KIT 9P3-SMCC-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 78.93% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | Kasumi-1 CDX model | ||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 84.35% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | HMC-1 CDX model | ||||
| In Vitro Model | Mast cell leukemia | HMC-1 cells | CVCL_0003 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST430 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST-T1 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive KIT expression (KIT+++/++) | ||
| Method Description |
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).
Click to Show/Hide
|
||||
| In Vivo Model | GIST-T1 CDX model | ||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
60%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
75%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
86%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H889 cells | CVCL_1598 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
87%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1930 cells | CVCL_1507 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
91%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
92%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
95%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
98%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H526 cells | CVCL_1569 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Essential thrombocythemia | UKE-1 cells | CVCL_0104 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
99%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | M-07e cells | CVCL_2106 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.02 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST-T1 cells | CVCL_4976 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.05 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H526 cells | CVCL_1569 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.05 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | CMK-11-5 cells | CVCL_0217 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.08 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.08 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute megakaryoblastic leukemia | M-07e cells | CVCL_2106 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.09 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1930 cells | CVCL_1507 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.11 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | OCI-M1 cells | CVCL_2149 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.15 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H889 cells | CVCL_1598 | ||
| Experiment 23 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.61 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 24 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.29 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | Kasumi-6 cells | CVCL_0614 | ||
| Experiment 25 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.8 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Essential thrombocythemia | UKE-1 cells | CVCL_0104 | ||
| Experiment 26 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
3.6 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 27 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
4 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 28 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
4.3 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
Anti-KIT 9P3-CX1-1-DM1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
95 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
55%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Max inhibition rate (MIR) |
100%
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.02 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
0.04 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Gastrointestinal stromal tumor | GIST430 cells | CVCL_7040 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
1.45 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H1048 cells | CVCL_1453 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
5.2 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | SKNO-1 cells | CVCL_2196 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximum Growth Inhibitory Concentration (GI50) |
7.6 nM
|
Positive KIT expression (KIT+++/++) | ||
| Method Description |
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.
Click to Show/Hide
|
||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
