General Information of This Antibody
Antibody ID
ANI0IZYHP
Antibody Name
Anti-KIT mAb 9P3
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Mast/stem cell growth factor receptor Kit (KIT)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQAPGKGLEWVANINYDGSSTYY
LDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGDYYGTTYWYFDVWGQGTTVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELL
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLTCLVKGFYPSDIAVEWESGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYYTSRLQSGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQQGKKLWSFGGGTKVEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anti-KIT 9P3?SPDB-DM4 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 31.88% (Day 14) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (1 mg/kg).

   Click to Show/Hide
In Vivo Model Kasumi-1 CDX model
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 91.94% (Day 35) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).

   Click to Show/Hide
In Vivo Model HMC-1 CDX model
In Vitro Model Mast cell leukemia HMC-1 cells CVCL_0003
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.00% (Day 50) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (2.5 mg/kg).

   Click to Show/Hide
In Vivo Model GIST-T1 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97.00% (Day 43) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).

   Click to Show/Hide
In Vivo Model GIST430 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.09% (Day 14) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).

   Click to Show/Hide
In Vivo Model Kasumi-1 CDX model
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100.00% (Day 50) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).

   Click to Show/Hide
In Vivo Model GIST-T1 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Revealed Based on the Cell Line Data
Click To Hide/Show 28 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
65.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
75.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
84.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H889 cells CVCL_1598
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
88.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1930 cells CVCL_1507
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
92.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia CMK-11-5 cells CVCL_0217
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
94.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
94.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia Kasumi-6 cells CVCL_0614
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
98.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H526 cells CVCL_1569
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia M-07e cells CVCL_2106
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia OCI-M1 cells CVCL_2149
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Essential thrombocythemia UKE-1 cells CVCL_0104
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.05 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.07 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia CMK-11-5 cells CVCL_0217
Experiment 17 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.11 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia M-07e cells CVCL_2106
Experiment 18 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.13 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia OCI-M1 cells CVCL_2149
Experiment 19 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.17 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 20 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.17 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H526 cells CVCL_1569
Experiment 21 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.30 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1930 cells CVCL_1507
Experiment 22 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.83 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 23 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.91 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia Kasumi-6 cells CVCL_0614
Experiment 24 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.26 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 25 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.47 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H889 cells CVCL_1598
Experiment 26 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.60 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 27 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
2.77 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Experiment 28 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
5.60 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Essential thrombocythemia UKE-1 cells CVCL_0104
Anti-KIT 9P3?SMCC-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 78.93% (Day 14) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).

   Click to Show/Hide
In Vivo Model Kasumi-1 CDX model
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 84.35% (Day 35) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with Kasumi-1 cells. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of 2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).

   Click to Show/Hide
In Vivo Model HMC-1 CDX model
In Vitro Model Mast cell leukemia HMC-1 cells CVCL_0003
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.00% (Day 43) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).

   Click to Show/Hide
In Vivo Model GIST430 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100.00% (Day 50) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (5 mg/kg).

   Click to Show/Hide
In Vivo Model GIST-T1 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100.00% (Day 50) Positive KIT expression (KIT+++/++)
Method Description
Female SCID-beige mice were implanted subcutaneously with 10,000,000 cells. The total injection volume containingcells in suspension was 200 ul. Mice were enrolled in the study 15 days post implantation withaverage tumor volume of about 120 mm3. All treated groups received a single intravenous dose of2 mg/kg. After being randomly assigned to groups (n = 8/group), mice were administered a single i.v.dose of TBS (5 ml/kg) or ADC (10 mg/kg).

   Click to Show/Hide
In Vivo Model GIST-T1 CDX model
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Revealed Based on the Cell Line Data
Click To Hide/Show 28 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
60.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
75.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
86.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H889 cells CVCL_1598
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
87.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1930 cells CVCL_1507
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
91.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia CMK-11-5 cells CVCL_0217
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
92.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia Kasumi-6 cells CVCL_0614
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
95.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
98.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H526 cells CVCL_1569
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia OCI-M1 cells CVCL_2149
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Essential thrombocythemia UKE-1 cells CVCL_0104
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
99.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia M-07e cells CVCL_2106
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.02 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST-T1 cells CVCL_4976
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.05 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia CMK-11-5 cells CVCL_0217
Experiment 17 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.05 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H526 cells CVCL_1569
Experiment 18 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.08 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute megakaryoblastic leukemia M-07e cells CVCL_2106
Experiment 19 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.08 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 20 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.09 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1930 cells CVCL_1507
Experiment 21 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.11 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia OCI-M1 cells CVCL_2149
Experiment 22 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.15 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H889 cells CVCL_1598
Experiment 23 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.61 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 24 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.29 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia Kasumi-6 cells CVCL_0614
Experiment 25 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.80 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Essential thrombocythemia UKE-1 cells CVCL_0104
Experiment 26 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
3.60 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 27 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
4.00 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 28 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
4.30 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Anti-KIT 9P3?CX1-1-DM1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 10 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
95.00 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
55.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Max inhibition rate (MIR)
100.00%
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.02 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
0.04 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Gastrointestinal stromal tumor GIST430 cells CVCL_7040
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
1.45 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H1048 cells CVCL_1453
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
5.20 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia SKNO-1 cells CVCL_2196
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximum Growth Inhibitory Concentration (GI50)
7.60 nM
Positive KIT expression (KIT+++/++)
Method Description
Cells were cultured in a tissue culture incubator at 37°C with 5% CO2 in culture medium. On the day of the assay, cells were washed twice with PBS, prior to being treated with 0.1% trypsin-EDTA for 5 min and resuspended in the recommended culture medium. Cells were then counted and seeded in 96 well plates at densities of 2,000-10,000 cells/well in 100 ul of cell culture medium.

   Click to Show/Hide
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
References
Ref 1 Antibody drug conjugates.