General Information of This Antigen
Antigen ID
TAR0MKNCY
Antigen Name
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5)
Gene Name
CEACAM5
Gene ID
1048
Synonym
CEA; Carcinoembryonic antigen;Meconium antigen 100;CD_antigen=CD66e
Sequence
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTI
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

    Click to Show/Hide
Family
CEA family
Function
Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.

    Click to Show/Hide
Uniprot Entry
CEAM5_HUMAN
HGNC ID
HGNC:1817
KEGG ID
hsa:1048
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Labetuzumab
ADC Info ADC Name Payload Target Linker Ref
Labetuzumab govitecan
Active metabolite of irinotecan SN38
DNA topoisomerase 1 (TOP1)
CL2A
[1]
Labetuzumab-PE40 conjugate
Pseudomonas exotoxin PE40
Eukaryotic elongation factor 2 (EEF2)
Undisclosed
[2]
DTPA-hMN-14-700DX
IRDye 700DX
Undisclosed
Undisclosed
[3]
Labetuzumab-CL2E-SN-38
Active metabolite of irinotecan SN38
DNA topoisomerase 1 (TOP1)
CL2E
[4]
Labetuzumab-SN-38
Active metabolite of irinotecan SN38
DNA topoisomerase 1 (TOP1)
CL2A
[4]
Lmab-CL2A-SN38
Active metabolite of irinotecan SN38
DNA topoisomerase 1 (TOP1)
CL2E
[5]
Tusamitamab
ADC Info ADC Name Payload Target Linker Ref
Tusamitamab ravtansine
Mertansine DM4
Microtubule (MT)
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB)
[6]
SAR-445953
7-aminomethyl-10,11-methylenedioxycamptothecin (AMDCPT)
DNA topoisomerase 1 (TOP1)
Undisclosed
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
M-9140
Exatecan
DNA topoisomerase 1 (TOP1)
Mal-glucuronide-PABC
[7]
IBI-3020
Monomethyl auristatin E+Undisclosed
Microtubule (MT)+.
Undisclosed
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000123668; Fold-change: -0.148798423; Z-score: -0.503764606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000123668; Fold-change: -0.148798423; Z-score: -0.503764606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.449353283; Fold-change: -0.002020821; Z-score: -0.078581791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.23E-05; Fold-change: -0.556402566; Z-score: -2.162163353
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002806987; Fold-change: -0.496549504; Z-score: -1.331515394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.124689338; Fold-change: 0.106465619; Z-score: 0.347324383
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.449353283; Fold-change: -0.002020821; Z-score: -0.078581791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.23E-05; Fold-change: -0.556402566; Z-score: -2.162163353
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002806987; Fold-change: -0.496549504; Z-score: -1.331515394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.124689338; Fold-change: 0.106465619; Z-score: 0.347324383
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532446544; Fold-change: 0.001210814; Z-score: 0.012670616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.690865032; Fold-change: -0.081384073; Z-score: -1.011745643
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532446544; Fold-change: 0.001210814; Z-score: 0.012670616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.690865032; Fold-change: -0.081384073; Z-score: -1.011745643
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.21902468; Fold-change: -0.045077086; Z-score: -0.211504247
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.092917496; Fold-change: -0.091241638; Z-score: -0.966912379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.21902468; Fold-change: -0.045077086; Z-score: -0.211504247
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.092917496; Fold-change: -0.091241638; Z-score: -0.966912379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.411168992; Fold-change: 0.003509137; Z-score: 0.024655682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.411168992; Fold-change: 0.003509137; Z-score: 0.024655682
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.331663823; Fold-change: 1.465867029; Z-score: 0.993110244
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.165485286; Fold-change: 0.256535409; Z-score: 0.3811221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.331663823; Fold-change: 1.465867029; Z-score: 0.993110244
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.165485286; Fold-change: 0.256535409; Z-score: 0.3811221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.09E-09; Fold-change: -0.02815906; Z-score: -0.132034482
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.578017716; Fold-change: -0.011021663; Z-score: -0.019876289
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.09E-09; Fold-change: -0.02815906; Z-score: -0.132034482
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.578017716; Fold-change: -0.011021663; Z-score: -0.019876289
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.56E-12; Fold-change: 2.750245887; Z-score: 4.334812416
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.68E-24; Fold-change: 2.52610346; Z-score: 2.825714417
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.56E-12; Fold-change: 2.750245887; Z-score: 4.334812416
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.68E-24; Fold-change: 2.52610346; Z-score: 2.825714417
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004850405; Fold-change: -0.094568445; Z-score: -0.639275905
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002573273; Fold-change: -0.044879775; Z-score: -0.201254253
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.828559922; Fold-change: -0.260784416; Z-score: -1.236757033
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004850405; Fold-change: -0.094568445; Z-score: -0.639275905
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002573273; Fold-change: -0.044879775; Z-score: -0.201254253
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.828559922; Fold-change: -0.260784416; Z-score: -1.236757033
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.59E-43; Fold-change: 1.212826852; Z-score: 1.593804521
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.64E-26; Fold-change: 1.198178284; Z-score: 1.432031388
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.59E-43; Fold-change: 1.212826852; Z-score: 1.593804521
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.64E-26; Fold-change: 1.198178284; Z-score: 1.432031388
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019586415; Fold-change: -0.419303187; Z-score: -0.485995346
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019586415; Fold-change: -0.419303187; Z-score: -0.485995346
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.13E-27; Fold-change: -0.176003299; Z-score: -1.243130977
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.854791986; Fold-change: -0.035252764; Z-score: -0.42425201
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.13E-27; Fold-change: -0.176003299; Z-score: -1.243130977
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.854791986; Fold-change: -0.035252764; Z-score: -0.42425201
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.68E-91; Fold-change: 0.291598431; Z-score: 1.072417282
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.01E-06; Fold-change: 0.165985394; Z-score: 0.252495126
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.68E-91; Fold-change: 0.291598431; Z-score: 1.072417282
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.01E-06; Fold-change: 0.165985394; Z-score: 0.252495126
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.601715005; Fold-change: -0.133787728; Z-score: -0.45187642
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000395194; Fold-change: -0.003173379; Z-score: -0.019778299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.601715005; Fold-change: -0.133787728; Z-score: -0.45187642
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000395194; Fold-change: -0.003173379; Z-score: -0.019778299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02017212; Fold-change: -0.250094866; Z-score: -0.579273163
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02017212; Fold-change: -0.250094866; Z-score: -0.579273163
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.91E-05; Fold-change: 0.343449523; Z-score: 0.311010545
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.21E-08; Fold-change: 0.492482447; Z-score: 2.883936455
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.91E-05; Fold-change: 0.343449523; Z-score: 0.311010545
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.21E-08; Fold-change: 0.492482447; Z-score: 2.883936455
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003113415; Fold-change: -0.436117254; Z-score: -1.114813424
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003113415; Fold-change: -0.436117254; Z-score: -1.114813424
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.74E-09; Fold-change: 1.101662888; Z-score: 4.072081676
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.74E-09; Fold-change: 1.101662888; Z-score: 4.072081676
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010192737; Fold-change: -0.111631389; Z-score: -0.781427696
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010192737; Fold-change: -0.111631389; Z-score: -0.781427696
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.610338215; Fold-change: -0.012337673; Z-score: -0.032144203
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.192525678; Fold-change: -0.041815482; Z-score: -0.122991812
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.610338215; Fold-change: -0.012337673; Z-score: -0.032144203
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.192525678; Fold-change: -0.041815482; Z-score: -0.122991812
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.027820734; Fold-change: -0.039607534; Z-score: -0.289255213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.027820734; Fold-change: -0.039607534; Z-score: -0.289255213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.03E-22; Fold-change: -1.338239406; Z-score: -1.636557431
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.03E-22; Fold-change: -1.338239406; Z-score: -1.636557431
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056510507; Fold-change: -0.078321459; Z-score: -0.836662306
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310900565; Fold-change: -0.021477726; Z-score: -0.050380355
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056510507; Fold-change: -0.078321459; Z-score: -0.836662306
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310900565; Fold-change: -0.021477726; Z-score: -0.050380355
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.365235665; Fold-change: 0.028649838; Z-score: 0.163784627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.365235665; Fold-change: 0.028649838; Z-score: 0.163784627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.289702918; Fold-change: -0.128279171; Z-score: -0.21108223
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.289702918; Fold-change: -0.128279171; Z-score: -0.21108223
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.075504088; Fold-change: -0.199620617; Z-score: -1.423258978
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.075504088; Fold-change: -0.199620617; Z-score: -1.423258978
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019228303; Fold-change: -0.03264173; Z-score: -0.244159299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019228303; Fold-change: -0.03264173; Z-score: -0.244159299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.579507463; Fold-change: -0.035897652; Z-score: -0.457049374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.579507463; Fold-change: -0.035897652; Z-score: -0.457049374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.183935865; Fold-change: -0.014088966; Z-score: -0.095283092
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481975916; Fold-change: 0.07688382; Z-score: 0.279602374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.183935865; Fold-change: -0.014088966; Z-score: -0.095283092
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481975916; Fold-change: 0.07688382; Z-score: 0.279602374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.0128409; Fold-change: 0.288415045; Z-score: 5.296323727
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.0128409; Fold-change: 0.288415045; Z-score: 5.296323727
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.395253254; Fold-change: 0.019039383; Z-score: 0.105160351
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.264808349; Fold-change: 0.015474993; Z-score: 0.118324073
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.395253254; Fold-change: 0.019039383; Z-score: 0.105160351
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.264808349; Fold-change: 0.015474993; Z-score: 0.118324073
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.239359799; Fold-change: -0.050044159; Z-score: -0.301300953
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.239359799; Fold-change: -0.050044159; Z-score: -0.301300953
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.07053515; Fold-change: 0.147672058; Z-score: 1.271936816
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.07053515; Fold-change: 0.147672058; Z-score: 1.271936816
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.216214386; Fold-change: 0.053204112; Z-score: 0.312416384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.216214386; Fold-change: 0.053204112; Z-score: 0.312416384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.878698788; Fold-change: 0.002003293; Z-score: 0.014334138
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.878698788; Fold-change: 0.002003293; Z-score: 0.014334138
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.779749957; Fold-change: 0.009976866; Z-score: 0.068966731
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.779749957; Fold-change: 0.009976866; Z-score: 0.068966731
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.446081466; Fold-change: 0.016391043; Z-score: 0.118966373
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.446081466; Fold-change: 0.016391043; Z-score: 0.118966373
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.524278202; Fold-change: -0.045352897; Z-score: -0.356488776
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.524278202; Fold-change: -0.045352897; Z-score: -0.356488776
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.439502361; Fold-change: 0.133802431; Z-score: 0.251733035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.439502361; Fold-change: 0.133802431; Z-score: 0.251733035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.670316513; Fold-change: -0.028811933; Z-score: -0.428349347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.670316513; Fold-change: -0.028811933; Z-score: -0.428349347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.282669712; Fold-change: 0.197365327; Z-score: 0.45168319
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.282669712; Fold-change: 0.197365327; Z-score: 0.45168319
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.991934416; Fold-change: 0.047796258; Z-score: 0.417190622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.991934416; Fold-change: 0.047796258; Z-score: 0.417190622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.247481363; Fold-change: 0.069979675; Z-score: 0.487743081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.247481363; Fold-change: 0.069979675; Z-score: 0.487743081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.819773065; Fold-change: 0.022706054; Z-score: 0.252025334
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.819773065; Fold-change: 0.022706054; Z-score: 0.252025334
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.174963999; Fold-change: 1.34598402; Z-score: 1.805971859
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.174963999; Fold-change: 1.34598402; Z-score: 1.805971859
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.41154029; Fold-change: 0.123407048; Z-score: 0.77148155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.41154029; Fold-change: 0.123407048; Z-score: 0.77148155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224285818; Fold-change: 0.224499821; Z-score: 0.307311623
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224285818; Fold-change: 0.224499821; Z-score: 0.307311623
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.475020718; Fold-change: 0.084023741; Z-score: 0.108289675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.56E-05; Fold-change: 0.41488498; Z-score: 0.456396041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.475020718; Fold-change: 0.084023741; Z-score: 0.108289675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.56E-05; Fold-change: 0.41488498; Z-score: 0.456396041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.04E-14; Fold-change: 0.953549245; Z-score: 1.005515741
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.04E-14; Fold-change: 0.953549245; Z-score: 1.005515741
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.979659786; Fold-change: 0.036918991; Z-score: 0.262248425
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.979659786; Fold-change: 0.036918991; Z-score: 0.262248425
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.615801253; Fold-change: 0.503080485; Z-score: 0.601773546
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.615801253; Fold-change: 0.503080485; Z-score: 0.601773546
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001369553; Fold-change: -0.161933842; Z-score: -0.55833394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001369553; Fold-change: -0.161933842; Z-score: -0.55833394
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.714000606; Fold-change: 0.059388921; Z-score: 0.281226805
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.714000606; Fold-change: 0.059388921; Z-score: 0.281226805
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028846997; Fold-change: 0.168139939; Z-score: 0.914073197
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028846997; Fold-change: 0.168139939; Z-score: 0.914073197
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.011155681; Fold-change: 0.200561306; Z-score: 0.621585332
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.011155681; Fold-change: 0.200561306; Z-score: 0.621585332
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.479638603; Fold-change: 0.043217115; Z-score: 0.33510747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.479638603; Fold-change: 0.043217115; Z-score: 0.33510747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040214644; Fold-change: 0.004800919; Z-score: 0.024628093
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040214644; Fold-change: 0.004800919; Z-score: 0.024628093
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000213875; Fold-change: 0.150239202; Z-score: 0.392891307
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.060724198; Fold-change: 0.066728552; Z-score: 0.184578754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000213875; Fold-change: 0.150239202; Z-score: 0.392891307
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.060724198; Fold-change: 0.066728552; Z-score: 0.184578754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.658383034; Fold-change: -0.136005864; Z-score: -0.291622169
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.658383034; Fold-change: -0.136005864; Z-score: -0.291622169
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009645311; Fold-change: 0.271101517; Z-score: 0.718668026
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009645311; Fold-change: 0.271101517; Z-score: 0.718668026
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021450981; Fold-change: -0.197650911; Z-score: -2.925077712
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021450981; Fold-change: -0.197650911; Z-score: -2.925077712
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271523767; Fold-change: -0.043501146; Z-score: -0.312124767
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271523767; Fold-change: -0.043501146; Z-score: -0.312124767
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.45581206; Fold-change: -0.014179417; Z-score: -0.137169324
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.45581206; Fold-change: -0.014179417; Z-score: -0.137169324
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006647596; Fold-change: 0.088559275; Z-score: 0.460054023
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006647596; Fold-change: 0.088559275; Z-score: 0.460054023
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127758221; Fold-change: -0.08237065; Z-score: -0.430221793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127758221; Fold-change: -0.08237065; Z-score: -0.430221793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.325011413; Fold-change: 0.02465716; Z-score: 0.243052275
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.325011413; Fold-change: 0.02465716; Z-score: 0.243052275
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.118557674; Fold-change: 0.134835983; Z-score: 1.03554745
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.118557674; Fold-change: 0.134835983; Z-score: 1.03554745
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.128505533; Fold-change: 0.088951603; Z-score: 0.47395134
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.128505533; Fold-change: 0.088951603; Z-score: 0.47395134
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025929111; Fold-change: 0.558905122; Z-score: 4.550616363
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025929111; Fold-change: 0.558905122; Z-score: 4.550616363
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224199651; Fold-change: -0.209595082; Z-score: -1.143322221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224199651; Fold-change: -0.209595082; Z-score: -1.143322221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.389493509; Fold-change: 0.011244412; Z-score: 0.095686932
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.389493509; Fold-change: 0.011244412; Z-score: 0.095686932
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001752373; Fold-change: -0.277768734; Z-score: -1.681816302
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.389522756; Fold-change: -0.026669838; Z-score: -0.336053086
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001752373; Fold-change: -0.277768734; Z-score: -1.681816302
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.389522756; Fold-change: -0.026669838; Z-score: -0.336053086
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.55E-06; Fold-change: -0.984069073; Z-score: -1.448553341
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.43E-14; Fold-change: -0.771628919; Z-score: -1.257534077
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.55E-06; Fold-change: -0.984069073; Z-score: -1.448553341
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.43E-14; Fold-change: -0.771628919; Z-score: -1.257534077
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.378605518; Fold-change: -0.576126666; Z-score: -0.594636105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.378605518; Fold-change: -0.576126666; Z-score: -0.594636105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532530523; Fold-change: 0.052314655; Z-score: 0.50569583
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.139260179; Fold-change: -0.112547864; Z-score: -0.628755524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532530523; Fold-change: 0.052314655; Z-score: 0.50569583
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.139260179; Fold-change: -0.112547864; Z-score: -0.628755524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.11E-34; Fold-change: -0.566325165; Z-score: -1.411396424
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.54E-38; Fold-change: -0.705331575; Z-score: -1.667963402
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.11E-34; Fold-change: -0.566325165; Z-score: -1.411396424
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.54E-38; Fold-change: -0.705331575; Z-score: -1.667963402
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171701511; Fold-change: -0.114978001; Z-score: -0.284617863
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.09E-10; Fold-change: -0.255740595; Z-score: -1.06329557
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171701511; Fold-change: -0.114978001; Z-score: -0.284617863
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.09E-10; Fold-change: -0.255740595; Z-score: -1.06329557
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.26936006; Fold-change: 0.025764758; Z-score: 0.034101997
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.26936006; Fold-change: 0.025764758; Z-score: 0.034101997
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.824699848; Fold-change: -0.008469125; Z-score: -0.079980179
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.824699848; Fold-change: -0.008469125; Z-score: -0.079980179
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002053305; Fold-change: 0.255107245; Z-score: 3.454021014
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002053305; Fold-change: 0.255107245; Z-score: 3.454021014
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043104631; Fold-change: 0.267548281; Z-score: 0.744280007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043104631; Fold-change: 0.267548281; Z-score: 0.744280007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.84615578; Fold-change: 0.122681674; Z-score: 0.703021579
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.84615578; Fold-change: 0.122681674; Z-score: 0.703021579
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033061095; Fold-change: -0.036513502; Z-score: -0.420523006
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033061095; Fold-change: -0.036513502; Z-score: -0.420523006
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000183288; Fold-change: -0.084617958; Z-score: -1.685972643
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000183288; Fold-change: -0.084617958; Z-score: -1.685972643
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.458016529; Fold-change: -0.122406342; Z-score: -1.817628615
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.357483708; Fold-change: 0.156427149; Z-score: 0.364887678
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.458016529; Fold-change: -0.122406342; Z-score: -1.817628615
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.357483708; Fold-change: 0.156427149; Z-score: 0.364887678
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.397553599; Fold-change: 0.040257782; Z-score: 0.344394942
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.397553599; Fold-change: 0.040257782; Z-score: 0.344394942
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.265605046; Fold-change: 0.040045309; Z-score: 0.370835957
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.265605046; Fold-change: 0.040045309; Z-score: 0.370835957
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.101892004; Fold-change: -0.145899573; Z-score: -0.904116754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.101892004; Fold-change: -0.145899573; Z-score: -0.904116754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.895067991; Fold-change: -0.001792909; Z-score: -0.015688873
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.895067991; Fold-change: -0.001792909; Z-score: -0.015688873
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.082595794; Fold-change: -0.042815644; Z-score: -0.370829807
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.082595794; Fold-change: -0.042815644; Z-score: -0.370829807
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.112908806; Fold-change: -0.040304341; Z-score: -0.287694541
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.112908806; Fold-change: -0.040304341; Z-score: -0.287694541
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.176877693; Fold-change: 0.034063474; Z-score: 0.665517132
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.176877693; Fold-change: 0.034063474; Z-score: 0.665517132
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271261681; Fold-change: -0.034775168; Z-score: -0.224391063
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271261681; Fold-change: -0.034775168; Z-score: -0.224391063
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.295352977; Fold-change: 0.022681084; Z-score: 0.143111235
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.295352977; Fold-change: 0.022681084; Z-score: 0.143111235
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.468734662; Fold-change: 0.048207556; Z-score: 0.418437843
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.468734662; Fold-change: 0.048207556; Z-score: 0.418437843
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.490332022; Fold-change: -0.051590624; Z-score: -0.523465824
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.490332022; Fold-change: -0.051590624; Z-score: -0.523465824
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.772198399; Fold-change: 0.017879455; Z-score: 0.165159977
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.772198399; Fold-change: 0.017879455; Z-score: 0.165159977
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.375453583; Fold-change: 0.0699482; Z-score: 0.770721328
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.375453583; Fold-change: 0.0699482; Z-score: 0.770721328
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.21866269; Fold-change: 0.044259758; Z-score: 0.333384308
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.588510935; Fold-change: 0.108348481; Z-score: 0.366913837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.21866269; Fold-change: 0.044259758; Z-score: 0.333384308
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.588510935; Fold-change: 0.108348481; Z-score: 0.366913837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.078720637; Fold-change: -0.091683927; Z-score: -0.388126874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.078720637; Fold-change: -0.091683927; Z-score: -0.388126874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.365419838; Fold-change: -0.069154884; Z-score: -0.308521433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.365419838; Fold-change: -0.069154884; Z-score: -0.308521433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Antibody conjugates of 7-ethyl-10-hydroxycamptothecin (SN-38) for targeted cancer chemotherapy. J Med Chem. 2008 Nov 13;51(21):6916-26. doi: 10.1021/jm800719t. Epub 2008 Oct 22.
Ref 2 Introduction to basic information on ADC drug Labetuzumab-PE40 conjugate; 27 Oct 2020.
Ref 3 Carcinoembryonic antigen-targeted photodynamic therapy in colorectal cancer models. EJNMMI Res. 2019 Dec 11;9(1):108. doi: 10.1186/s13550-019-0580-z.
Ref 4 Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34. doi: 10.1158/1535-7163.MCT-11-0632. Epub 2011 Oct 28.
Ref 5 Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34.
Ref 6 Open-label, Phase 2 Study, Evaluating the Efficacy and Safety of Tusamitamab Ravtansine in Non-squamous Non-small-cell Lung Cancer (NSQ NSCLC) Participants With Negative or Moderate CEACAM5 Expression Tumors and High Circulating CEA, NCT05245071
Ref 7 Anti-CEACAM5 ADC M9140 in Advanced Solid Tumors; NCT05464030.