Antibody Information
General Information of This Antibody
| Antibody ID | ANI0BJQGX |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Labetuzumab |
|||||
| Brand Name | CEACIDE |
|||||
| Organization | Immunomedics, Inc. |
|||||
| Indication | Colorectal cancer |
|||||
| Synonyms |
hMN14; CEA-CIDE; hMN 14; hMN-14
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-nd |
|||||
| Antigen Name | Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| DrugBank ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGVVQPGRSLRLSCSASGFDFTTYWMSWVRQAPGKGLEWIGEIHPDSSTINY
APSLKDRFTISRDNAKNTLFLQMDSLRPEDTGVYFCASLYFGFPWFAYWGQGTPVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQLTQSPSSLSASVGDRVTITCKASQDVGTSVAWYQQKPGKAPKLLIYWTSTRHTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCQQYSLYRSFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Labetuzumab govitecan [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Relapsed or refractory metastatic colorectal cancer (mCRC) who had received at least one prior irinotecan-containing regimen.
|
||||
| Administration Dosage |
Once weekly at 8 and 10 mg/kg, or two times per week at 4 and 6 mg/km on weeks 1 and 2 of 3-week repeated cycles, intravenous.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01605318 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1/2 study of once or twice weekly IMMU-130 (hMN-14-SN38, antibody-drug conjugate) in patients with colorectal cancer.
|
||||
| Primary Endpoint |
The median PFS for all 86 patients was 3.60 months (95% CI,2.00 months to 4.00 months), with 16.8% (14 of 86) remaining progression free for at least 6 months, including three patients who maintained this status for at least 1 year. The median OS was 6.90 months (95% CI, 5.70 months to 7.80 months), with 24.41% (21 of 86) surviving for at least 1 year, including three patients who survived at least 2 years (one for 3 years).
Click to Show/Hide
|
||||
| Other Endpoint |
In the regorafenib subset (n = 23), the median PFS and OS were 3.90 and 6.70 months, respectively.
|
||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.23 nM
|
|||
| Method Description |
The inhibitory activity of IMMU-130 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 4 days.
|
||||
| In Vitro Model | Prostate carcinoma | 22RV1 cells | CVCL_1045 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.04 nM
|
|||
| Method Description |
The inhibitory activity of IMMU-130 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 4 days.
|
||||
| In Vitro Model | Prostate carcinoma | DU145 cells | CVCL_0105 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
140.00 nM
|
|||
| Method Description |
The inhibitory activity of IMMU-130 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 4 days.
|
||||
| In Vitro Model | Prostate cancer | MSKCC EF1 cells | Homo sapiens | ||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.32 uM
|
|||
| Method Description |
The inhibitory activity of IMMU-130 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 4 days.
|
||||
| In Vitro Model | Prostate small cell carcinoma | NCI-H660 cells | CVCL_1576 | ||
Labetuzumab-CL2E-SN-38 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Median survival time (MST) |
63 Day
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
The intravenous WSU-FSCCL models were initiated by intravenous injection of 2.5 x 106 cells, in female severe combined immunodeficient (SCID) mice (Taconic). The dose was 0.30 mg/dose (4.8 g SN-38 equivalents).
|
||||
| In Vivo Model | WSU-FSCCL CDX model | ||||
| In Vitro Model | Follicular lymphoma | WSU-FSCCL cells | CVCL_1903 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Median survival time (MST) |
76 Day
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
The intravenous WSU-FSCCL models were initiated by intravenous injection of 2.5 x 106 cells, in female severe combined immunodeficient (SCID) mice (Taconic). The dose was 0.15 mg/dose (2.4 g SN-38 equivalents).
|
||||
| In Vivo Model | WSU-FSCCL CDX model | ||||
| In Vitro Model | Follicular lymphoma | WSU-FSCCL cells | CVCL_1903 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Median survival time (MST) |
91 Day
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
The intravenous WSU-FSCCL models were initiated by intravenous injection of 2.5 x 106 cells, in female severe combined immunodeficient (SCID) mice (Taconic). The dose was 0.30 mg/dose (4.8 g SN-38 equivalents) plus Veltuzumab, 35 ug/dose.
|
||||
| In Vivo Model | WSU-FSCCL CDX model | ||||
| In Vitro Model | Follicular lymphoma | WSU-FSCCL cells | CVCL_1903 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Median survival time (MST) |
98 Day
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
The intravenous WSU-FSCCL models were initiated by intravenous injection of 2.5 x 106 cells, in female severe combined immunodeficient (SCID) mice (Taconic). The dose was 0.15 mg/dose (2.4 g SN-38 equivalents) plus Veltuzumab, 35 ug/dose.
|
||||
| In Vivo Model | WSU-FSCCL CDX model | ||||
| In Vitro Model | Follicular lymphoma | WSU-FSCCL cells | CVCL_1903 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
1.17 nM
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Mantle cell lymphoma | JeKo-1 cells | CVCL_1865 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
3.73 nM
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | EBV-related Burkitt lymphoma | Raji cells | CVCL_0511 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
8.08 nM
|
Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Negative CEACAM5 expression (CEACAM5-) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Low CEACAM5 expression (CEACAM5+) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Follicular lymphoma | WSU-FSCCL cells | CVCL_1903 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Negative CEACAM5 expression (CEACAM5-) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | Reh cells | CVCL_1650 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Negative CEACAM5 expression (CEACAM5-) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Childhood B acute lymphoblastic leukemia | 697 cells | CVCL_0079 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Negative CEACAM5 expression (CEACAM5-) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Adult B acute lymphoblastic leukemia | RS4;11 cells | CVCL_0093 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) | > 50.00 nM | Negative CEACAM5 expression (CEACAM5-) | ||
| Method Description |
Cytotoxicity was determined using the MTS dye reduction assay.
|
||||
| In Vitro Model | Burkitt lymphoma | MN-60 cells | CVCL_1421 | ||
Lmab-CL2A-SN38 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
1.70 nM
|
|||
| Method Description |
In vitro cytotoxicity by MTS assay of SN-38 and specific ADC conjugates against several hematopoietic tumor cell lines. The effect of linkage stability on the cytotoxicity of antibody conjugates as determined by a 4-day MTS assay.
|
||||
| In Vitro Model | B acute lymphoblastic leukemia | Reh cells | CVCL_1650 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
2.80 nM
|
|||
| Method Description |
In vitro cytotoxicity by MTS assay of SN-38 and specific ADC conjugates against several hematopoietic tumor cell lines. The effect of linkage stability on the cytotoxicity of antibody conjugates as determined by a 4-day MTS assay.
|
||||
| In Vitro Model | EBV-related Burkitt lymphoma | Raji cells | CVCL_0511 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
5.10 nM
|
|||
| Method Description |
In vitro cytotoxicity by MTS assay of SN-38 and specific ADC conjugates against several hematopoietic tumor cell lines. The effect of linkage stability on the cytotoxicity of antibody conjugates as determined by a 4-day MTS assay.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.