Antigen Information

General Information of This Antigen

Antigen ID	TAR0KVKEF
Antigen Name	HLA class II histocompatibility antigen gamma chain (CD74)
Gene Name	CD74
Synonym	DHLAG; HLA-DR antigens-associated invariant chain;Ia antigen-associated invariant chain;CD_antigen=CD74
Sequence	MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM Click to Show/Hide
Function	Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. Click to Show/Hide
Uniprot Entry	HG2A_HUMAN
HGNC ID	HGNC:1697
KEGG ID	hsa:972

Each Antibody-drug Conjuate AND It's Component Related to This Antigen

Full List of The ADC Related to This Antigen

Anti-CD74 antibody

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	S227928	S64315 (MIK665)	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1)	Val-Cit-(PEG24) linker

Anti-hCD74 clone11

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD74 ADC 12-13	Anti-CD74 ADC 12-13 payload	Undisclosed	Anti-CD74 ADC 12-13 linker	[1]
ADC Info	Anti-CD74 ADC 12-14	Anti-CD74 ADC 12-14 payload	Undisclosed	Anti-CD74 ADC 12-14 linker	[1]
ADC Info	Anti-CD74 ADC 12-15	Anti-CD74 ADC 12-15 payload	Undisclosed	Anti-CD74 ADC 12-15 linker	[1]

Anti-hCD74 LL1

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD74 ADC 12-4	Anti-CD74 ADC 12-4 payload	Undisclosed	Anti-CD74 ADC 12-4 linker	[1]
ADC Info	Anti-CD74 ADC 2-7	Anti-CD74 ADC 2-7 payload	Undisclosed	Anti-CD74 ADC 2-7 linker	[1]
ADC Info	Anti-CD74 ADC 3-4	Anti-CD74 ADC 3-4 payload	Undisclosed	Anti-CD74 ADC 3-4 linker	[1]
ADC Info	Anti-CD74 ADC 4-3	Anti-CD74 ADC 4-3 payload	Undisclosed	Anti-CD74 ADC 4-3 linker	[1]
ADC Info	Anti-CD74 ADC 5-3	Anti-CD74 ADC 5-3 payload	Undisclosed	Anti-CD74 ADC 5-3 linker	[1]
ADC Info	Anti-CD74 ADC 6-2	Anti-CD74 ADC 6-2 payload	Undisclosed	Anti-CD74 ADC 6-2 linker	[1]
ADC Info	Anti-CD74 ADC 7-1	Anti-CD74 ADC 7-1 payload	Undisclosed	Anti-CD74 ADC 7-1 linker	[1]
ADC Info	Anti-CD74 ADC 8-5	Anti-CD74 ADC 8-5 payload	Undisclosed	Anti-CD74 ADC 8-5 linker	[1]
ADC Info	Anti-CD74 ADC 9-4	Anti-CD74 ADC 9-4 payload	Undisclosed	Anti-CD74 ADC 9-4 linker	[1]
ADC Info	Anti-CD74 ADC 10-1	Anti-CD74 ADC 10-1 payload	Undisclosed	Anti-CD74 ADC 10-1 linker	[1]
ADC Info	Anti-CD74 ADC 11-5	Anti-CD74 ADC 11-5 payload	Undisclosed	Anti-CD74 ADC 11-5 linker	[1]
ADC Info	Anti-CD74 ADC 12-3	Anti-CD74 ADC 12-3 payload	Undisclosed	Anti-CD74 ADC 12-3 linker	[1]
ADC Info	Anti-CD74 ADC 13-7	Anti-CD74 ADC 13-7 payload	Undisclosed	Anti-CD74 ADC 13-7 linker	[1]
ADC Info	Anti-CD74 ADC 14-5	Anti-CD74 ADC 14-5 payload	Undisclosed	Anti-CD74 ADC 14-5 linker	[1]
ADC Info	Anti-CD74 ADC 15-5	Anti-CD74 ADC 15-5 payload	Undisclosed	Anti-CD74 ADC 15-5 linker	[1]
ADC Info	Anti-CD74 ADC 16-5	Anti-CD74 ADC 16-5 payload	Undisclosed	Anti-CD74 ADC 16-5 linker	[1]
ADC Info	Anti-CD74 ADC 17-2	Anti-CD74 ADC 17-2 payload	Undisclosed	Anti-CD74 ADC 17-2 linker	[1]

Bezetabart

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Bezetabart debotansine	SC347	Microtubule (MT)	Cys-12 ADC linker

CD74 Milatuzumab DANAPAE152C S375C

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L35-P1	P1 payload	Undisclosed	L35 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L12-P4	P4 payload	Undisclosed	L12 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L12-P3	P3 payload	Undisclosed	L12 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P2-L13-P1	P1 payload	Undisclosed	L13 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L32-P2	P2 payload	Undisclosed	L32 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L30-P2	P2 payload	Undisclosed	L30 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L17-P2	P2 payload	Undisclosed	L17 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L27-P1	P1 payload	Undisclosed	L27 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L11-P1	P1 payload	Undisclosed	L11 linker	[2]
ADC Info	CD74 Milatuzumab DANAPAE152C S375C-P1-L18-P2	P2 payload	Undisclosed	L18 linker	[2]

HuMab-CD74-005

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HuMab-CD74-005-vcMMAE	Monomethyl auristatin E	Undisclosed	Mc-Val-Cit-PABC	[3]
ADC Info	HuMab-CD74-005-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[3]

HuMab-CD74-006

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HuMab-CD74-006-vcMMAE	Monomethyl auristatin E	Undisclosed	Mc-Val-Cit-PABC	[3]
ADC Info	HuMab-CD74-006-mcMMAF	Monomethyl auristatin F	Microtubule (MT)	Undisclosed	[3]

HuMab-CD74-011

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	HuMab-CD74-011-vcMMAE	Monomethyl auristatin E	Undisclosed	Mc-Val-Cit-PABC	[3]

Milatuzumab

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Milatuzumab doxorubicin	Doxorubicin	DNA topoisomerase 2-alpha (TOP2A)	SMCC-hydrazide
ADC Info	Milatuzumab-RSL3-NH2	RSL3-NH2	Phospholipid hydroperoxide glutathione peroxidase (GPX4)	Mal-PEG4-DBCO-Ala-Val	[4]
ADC Info	HLL1-CL2A-SN38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[5]

Undisclosed

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Antibody-drug conjugate (Ambrx Inc)	Undisclosed	Undisclosed	Undisclosed	[6]

References

Ref 1	Antibody drug conjugate for anti-inflammatory applications; 2017-04-13.
Ref 2	Antibody-drug conjugates of antineoplastic compounds and methods of use thereof
Ref 3	Antibodies, expression vectors, recombinant prokaryotic host cells, pharmaceutical compositions, and uses of the antibody
Ref 4	The first ADC bearing the ferroptosis inducer RSL3 as a payload with conservation of the fragile electrophilic warhead. Eur J Med Chem. 2022 Dec 15;244:114863.
Ref 5	Optimal cleavable linker for antibody-SN-38 conjugates for cancer therapy: Impact of linker's stability on efficacy. Cancer Res (2012) 72 (8_Supplement): 2526.
Ref 6	Introduction to basic information on ADC drug Antibody-drug conjugate (Ambrx Inc)

Antigen Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)