Antigen Information
General Information of This Antigen
Antigen ID | TAR0KVKEF |
|||||
---|---|---|---|---|---|---|
Antigen Name | HLA class II histocompatibility antigen gamma chain (CD74) |
|||||
Gene Name | CD74 |
|||||
Gene ID | ||||||
Synonym | DHLAG; HLA-DR antigens-associated invariant chain;Ia antigen-associated invariant chain;CD_antigen=CD74 |
|||||
Sequence |
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM Click to Show/Hide
|
|||||
Function |
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
Click to Show/Hide
|
|||||
Uniprot Entry | ||||||
HGNC ID | ||||||
KEGG ID |
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-hCD74 clone11
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Anti-CD74 ADC 12-13 |
Anti-CD74 ADC 12-13 payload |
Undisclosed |
Anti-CD74 ADC 12-13 linker |
[1] | |
Anti-CD74 ADC 12-14 |
Anti-CD74 ADC 12-14 payload |
Undisclosed |
Anti-CD74 ADC 12-14 linker |
[1] | |
Anti-CD74 ADC 12-15 |
Anti-CD74 ADC 12-15 payload |
Undisclosed |
Anti-CD74 ADC 12-15 linker |
[1] |
Anti-hCD74 LL1
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Anti-CD74 ADC 12-4 |
Anti-CD74 ADC 12-4 payload |
Undisclosed |
Anti-CD74 ADC 12-4 linker |
[1] | |
Anti-CD74 ADC 2-7 |
Anti-CD74 ADC 2-7 payload |
Undisclosed |
Anti-CD74 ADC 2-7 linker |
[1] | |
Anti-CD74 ADC 3-4 |
Anti-CD74 ADC 3-4 payload |
Undisclosed |
Anti-CD74 ADC 3-4 linker |
[1] | |
Anti-CD74 ADC 4-3 |
Anti-CD74 ADC 4-3 payload |
Undisclosed |
Anti-CD74 ADC 4-3 linker |
[1] | |
Anti-CD74 ADC 5-3 |
Anti-CD74 ADC 5-3 payload |
Undisclosed |
Anti-CD74 ADC 5-3 linker |
[1] | |
Anti-CD74 ADC 6-2 |
Anti-CD74 ADC 6-2 payload |
Undisclosed |
Anti-CD74 ADC 6-2 linker |
[1] | |
Anti-CD74 ADC 7-1 |
Anti-CD74 ADC 7-1 payload |
Undisclosed |
Anti-CD74 ADC 7-1 linker |
[1] | |
Anti-CD74 ADC 8-5 |
Anti-CD74 ADC 8-5 payload |
Undisclosed |
Anti-CD74 ADC 8-5 linker |
[1] | |
Anti-CD74 ADC 9-4 |
Anti-CD74 ADC 9-4 payload |
Undisclosed |
Anti-CD74 ADC 9-4 linker |
[1] | |
Anti-CD74 ADC 10-1 |
Anti-CD74 ADC 10-1 payload |
Undisclosed |
Anti-CD74 ADC 10-1 linker |
[1] | |
Anti-CD74 ADC 11-5 |
Anti-CD74 ADC 11-5 payload |
Undisclosed |
Anti-CD74 ADC 11-5 linker |
[1] | |
Anti-CD74 ADC 12-3 |
Anti-CD74 ADC 12-3 payload |
Undisclosed |
Anti-CD74 ADC 12-3 linker |
[1] | |
Anti-CD74 ADC 14-5 |
Anti-CD74 ADC 14-5 payload |
Undisclosed |
Anti-CD74 ADC 14-5 linker |
[1] | |
Anti-CD74 ADC 15-5 |
Anti-CD74 ADC 15-5 payload |
Undisclosed |
Anti-CD74 ADC 15-5 linker |
[1] | |
Anti-CD74 ADC 16-5 |
Anti-CD74 ADC 16-5 payload |
Undisclosed |
Anti-CD74 ADC 16-5 linker |
[1] | |
Anti-CD74 ADC 17-2 |
Anti-CD74 ADC 17-2 payload |
Undisclosed |
Anti-CD74 ADC 17-2 linker |
[1] | |
Anti-CD74 ADC 13-7 |
Anti-CD74 ADC 13-7 payload |
Undisclosed |
Anti-CD74 ADC 13-7 linker |
[1] |
Milatuzumab
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Milatuzumab-RSL3-NH2 |
RSL3-NH2 |
Phospholipid hydroperoxide glutathione peroxidase (GPX4) |
Mal-PEG4-DBCO-Ala-Val |
[2] | |
HLL1-CL2A-SN38 |
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
[3] | |
Milatuzumab doxorubicin |
Doxorubicin |
DNA topoisomerase 2-alpha (TOP2A) |
Mcc-hydrazide |
[4] |
Undisclosed
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
STRO-001 |
Maytansinoid derivative |
Microtubule (MT) |
Cys-12 ADC linker |
[5] | |
Antibody-drug conjugate (Ambrx Inc) |
Undisclosed |
Undisclosed |
Undisclosed |
[6] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Bacterial infection of gingival | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.87E-10; Fold-change: 0.985924753; Z-score: 1.120351482 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Brainstem | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.69364689; Fold-change: -0.632916324; Z-score: -0.569787239 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | White matter | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.688820034; Fold-change: 0.284524897; Z-score: 0.240368999 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem | |
The Specific Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.68E-08; Fold-change: -3.840192544; Z-score: -5.235819407 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Nervous | |
The Specific Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.71E-05; Fold-change: -0.054530383; Z-score: -0.052682617 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Polycythemia vera | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.189512557; Fold-change: -0.023055898; Z-score: -0.163217549 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Whole blood | |
The Specific Disease | Myelofibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000179052; Fold-change: -0.186728483; Z-score: -1.312535437 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myelodysplastic syndromes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.393303633; Fold-change: 0.037302355; Z-score: 0.143446821 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.092247436; Fold-change: -0.301317215; Z-score: -1.02968869 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Tonsil | |
The Specific Disease | Lymphoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.600844272; Fold-change: 0.027739437; Z-score: 0.091669217 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric | |
The Specific Disease | Gastric cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.392399831; Fold-change: -0.450126006; Z-score: -0.297239233 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.217907537; Fold-change: 1.635861416; Z-score: 0.824056523 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon | |
The Specific Disease | Colon cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.19E-19; Fold-change: -1.050225786; Z-score: -0.896932812 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.806565896; Fold-change: 0.338768397; Z-score: 0.235389869 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pancreas | |
The Specific Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.75E-05; Fold-change: 0.682346942; Z-score: 0.923403619 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.075997659; Fold-change: -0.300718379; Z-score: -0.18372516 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.149658108; Fold-change: -0.108393802; Z-score: -0.094572115 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.442254976; Fold-change: 0.411771772; Z-score: 0.244443316 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.701503567; Fold-change: -0.574796238; Z-score: -0.273596342 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.90E-58; Fold-change: -2.236302263; Z-score: -1.837732488 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.17E-20; Fold-change: -2.604781786; Z-score: -1.33704989 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034181072; Fold-change: 0.553666787; Z-score: 0.323841293 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Sarcoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.62E-66; Fold-change: 1.309113761; Z-score: 2.083781457 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000527391; Fold-change: 1.320121996; Z-score: 4.582081823 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Breast | |
The Specific Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.118756168; Fold-change: 0.230613538; Z-score: 0.155314695 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.017452709; Fold-change: -0.423938538; Z-score: -0.337719067 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Ovarian | |
The Specific Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.030667343; Fold-change: 0.999668213; Z-score: 0.8190751 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.31E-05; Fold-change: 2.226855633; Z-score: 1.994386659 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Cervical | |
The Specific Disease | Cervical cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.64E-09; Fold-change: 0.046245454; Z-score: 0.242282696 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Uterine cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.11E-06; Fold-change: 0.059148259; Z-score: 0.06601752 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.42E-06; Fold-change: 0.753898816; Z-score: 2.867606721 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Prostate | |
The Specific Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.017777479; Fold-change: 1.951745999; Z-score: 1.268104457 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000708479; Fold-change: -1.704336376; Z-score: -2.565301332 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Uvea | |
The Specific Disease | Retinoblastoma tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.005759217; Fold-change: 1.43737056; Z-score: 6.833969269 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Thyroid | |
The Specific Disease | Thyroid cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001051352; Fold-change: 0.865191076; Z-score: 0.594024659 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000298126; Fold-change: 1.057898956; Z-score: 0.73144755 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adrenal cortex | |
The Specific Disease | Adrenocortical carcinoma | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.001653252; Fold-change: -1.150530712; Z-score: -0.857173348 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Head and neck | |
The Specific Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.137514045; Fold-change: -0.201439676; Z-score: -0.128729638 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.070058912; Fold-change: -0.505545857; Z-score: -0.471553712 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.32449028; Fold-change: 0.018290588; Z-score: 0.020043674 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.377758406; Fold-change: 0.561275085; Z-score: 0.390484454 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Lupus erythematosus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.078916542; Fold-change: 0.057687105; Z-score: 0.028089262 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral monocyte | |
The Specific Disease | Autoimmune uveitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.152496095; Fold-change: 0.61827318; Z-score: 1.810462336 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Familial hypercholesterolemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011415829; Fold-change: 0.554154983; Z-score: 1.043010137 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Superior temporal cortex | |
The Specific Disease | Schizophrenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.06899886; Fold-change: 0.400575885; Z-score: 0.816107378 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Spinal cord | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.224556114; Fold-change: 0.885007009; Z-score: 1.674924877 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Plasmacytoid dendritic cells | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.048737719; Fold-change: 0.598399323; Z-score: 1.01073048 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peritumoral cortex | |
The Specific Disease | Epilepsy | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.399764362; Fold-change: -2.397869496; Z-score: -1.122628358 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Cardioembolic Stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.53E-12; Fold-change: -0.718583366; Z-score: -2.492289975 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Ischemic stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.085180902; Fold-change: -0.586622812; Z-score: -1.345547418 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | White matter | |
The Specific Disease | HIV | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.117977453; Fold-change: 0.056399222; Z-score: 0.125621246 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Influenza | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.542017006; Fold-change: -0.262224791; Z-score: -7.796027748 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Chronic hepatitis C | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.749076931; Fold-change: 0.005355382; Z-score: 0.044907932 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Sepsis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.541363255; Fold-change: -0.149726597; Z-score: -0.245359968 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Septic shock | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001132393; Fold-change: -0.080428907; Z-score: -0.177384021 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Pediatric respiratory syncytial virus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.035021064; Fold-change: -0.355497681; Z-score: -0.80294377 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Essential hypertension | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.22718865; Fold-change: 0.212507376; Z-score: 1.498357351 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myocardial infarction | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.784580448; Fold-change: 0.272284166; Z-score: 0.198416642 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Coronary artery disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.395777775; Fold-change: -0.440067251; Z-score: -1.012609219 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Calcified aortic valve | |
The Specific Disease | Aortic stenosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.278166612; Fold-change: 0.441993537; Z-score: 0.618645786 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arteriosclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.036306597; Fold-change: -0.230118773; Z-score: -0.763791959 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Intracranial artery | |
The Specific Disease | Aneurysm | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002390826; Fold-change: 0.850779101; Z-score: 2.145592052 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Immunodeficiency | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.763802248; Fold-change: 0.015626073; Z-score: 0.106883681 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Hyperplastic tonsil | |
The Specific Disease | Apnea | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.530595272; Fold-change: -0.127621512; Z-score: -0.536313729 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Olive pollen allergy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.593265734; Fold-change: 0.454139584; Z-score: 0.559539437 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Sinus mucosa | |
The Specific Disease | Chronic rhinosinusitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.04742723; Fold-change: 1.156385153; Z-score: 1.110281347 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.997520686; Fold-change: -0.208116375; Z-score: -0.202942531 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Small airway epithelium | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.167795579; Fold-change: -0.266517811; Z-score: -0.27536319 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal and bronchial airway | |
The Specific Disease | Asthma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.084144953; Fold-change: -0.037417222; Z-score: -0.017621122 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal Epithelium | |
The Specific Disease | Human rhinovirus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.082729766; Fold-change: -0.085817328; Z-score: -0.145943675 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Idiopathic pulmonary fibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.74E-06; Fold-change: 1.38878292; Z-score: 5.603185488 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Periodontal disease | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.43E-07; Fold-change: 0.787684305; Z-score: 0.899837186 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric antrum | |
The Specific Disease | Eosinophilic gastritis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.552916614; Fold-change: 0.25322802; Z-score: 0.453628042 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver failure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.24E-05; Fold-change: 0.88925855; Z-score: 3.994812137 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon mucosal | |
The Specific Disease | Ulcerative colitis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.0017474; Fold-change: 0.061207265; Z-score: 0.229004701 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Irritable bowel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.10327127; Fold-change: -0.478177816; Z-score: -0.577488969 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Atopic dermatitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.033344949; Fold-change: -0.677856364; Z-score: -0.781865518 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Psoriasis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.05103656; Fold-change: 0.103801476; Z-score: 0.101418762 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.51E-10; Fold-change: -0.608839582; Z-score: -0.875102074 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Vitiligo | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.69913952; Fold-change: 0.296697643; Z-score: 0.948196431 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin from scalp | |
The Specific Disease | Alopecia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.015093941; Fold-change: 0.394076848; Z-score: 0.666627186 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Sensitive skin | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.8906666; Fold-change: 0.120209896; Z-score: 0.308527957 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Osteoarthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.736253017; Fold-change: -0.078364816; Z-score: -0.089280491 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthropathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.548500591; Fold-change: -0.038604401; Z-score: -0.079440295 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.76E-10; Fold-change: -1.220004984; Z-score: -1.392680993 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Rheumatoid arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.40E-05; Fold-change: 1.351435307; Z-score: 2.913803701 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pheripheral blood | |
The Specific Disease | Ankylosing spondylitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.710348746; Fold-change: -0.437960689; Z-score: -0.805555853 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Osteoporosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.006427598; Fold-change: 1.359163821; Z-score: 5.116530987 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Endometriosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.099272948; Fold-change: 0.239015574; Z-score: 0.361637311 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Interstitial cystitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.117707625; Fold-change: 1.126467809; Z-score: 1.330357665 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Myometrium | |
The Specific Disease | Preterm birth | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.73629551; Fold-change: -0.295680476; Z-score: -0.25667199 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Acute myelocytic leukemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.28E-14; Fold-change: 0.176337866; Z-score: 0.382880538 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012802479; Fold-change: -0.839763542; Z-score: -1.676221734 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.423706155; Fold-change: -0.026694639; Z-score: -0.069103253 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Oral | |
The Specific Disease | Oral cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.529649839; Fold-change: -0.339366945; Z-score: -0.400790392 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.600483438; Fold-change: 0.130158359; Z-score: 0.108308016 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Esophagus | |
The Specific Disease | Esophagal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.152847579; Fold-change: -0.977558768; Z-score: -1.107920658 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Rectal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.028151593; Fold-change: -0.630054124; Z-score: -1.094278175 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.020393567; Fold-change: -0.987401281; Z-score: -1.555995475 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Skin cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.676141705; Fold-change: 0.002506587; Z-score: 0.002664259 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.011755149; Fold-change: -0.656302028; Z-score: -0.469042321 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Kidney | |
The Specific Disease | Renal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.181882472; Fold-change: 0.970103035; Z-score: 0.733301098 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.009281684; Fold-change: -0.271501433; Z-score: -0.263542629 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Urothelium | |
The Specific Disease | Ureter cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.846220718; Fold-change: 0.121670551; Z-score: 0.291636243 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adipose | |
The Specific Disease | Simpson golabi behmel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.755678462; Fold-change: -0.013422071; Z-score: -0.127953118 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Perituberal | |
The Specific Disease | Tuberous sclerosis complex | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.06237999; Fold-change: 1.131150119; Z-score: 5.613145201 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Anemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.018008996; Fold-change: -0.708711471; Z-score: -1.88825379 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Sickle cell disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.433369756; Fold-change: 0.064603548; Z-score: 0.237717991 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocythemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.111677186; Fold-change: -0.070850911; Z-score: -0.522947568 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Scleroderma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.34996585; Fold-change: -0.225109368; Z-score: -0.696358116 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Salivary gland | |
The Specific Disease | Sjogren syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008657838; Fold-change: 0.743866853; Z-score: 4.325629776 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.373180888; Fold-change: 0.20969979; Z-score: 0.993876248 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Behcet disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.496211901; Fold-change: 0.206213569; Z-score: 0.420268352 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autosomal dominant monocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.304795187; Fold-change: 0.616228394; Z-score: 1.0741931 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.676919748; Fold-change: 0.001442545; Z-score: 0.010115071 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Vastus lateralis muscle | |
The Specific Disease | Polycystic ovary syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.112905162; Fold-change: -0.076554917; Z-score: -0.407401792 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Subcutaneous Adipose | |
The Specific Disease | Obesity | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.430521823; Fold-change: 0.061768556; Z-score: 0.285928041 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Biceps muscle | |
The Specific Disease | Pompe disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.056826321; Fold-change: 1.086453742; Z-score: 0.96770283 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Batten disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.187913947; Fold-change: 0.204704877; Z-score: 0.935294563 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autism | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.033261457; Fold-change: -0.255018352; Z-score: -0.359076134 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Anxiety disorder | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.381735471; Fold-change: -0.137512682; Z-score: -0.212947672 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Substantia nigra | |
The Specific Disease | Parkinson disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.927400679; Fold-change: 0.058135636; Z-score: 0.061524943 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Huntington disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.386499082; Fold-change: 0.148043762; Z-score: 0.208857472 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Entorhinal cortex | |
The Specific Disease | Alzheimer disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.93E-10; Fold-change: 0.808689296; Z-score: 0.928849459 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Seizure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.919646022; Fold-change: 0.038560181; Z-score: 0.059542876 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.772593869; Fold-change: 0.063984449; Z-score: 0.862886833 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Cervical spinal cord | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.342655355; Fold-change: -0.014578534; Z-score: -0.03503659 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Muscular atrophy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.80E-08; Fold-change: 1.53185648; Z-score: 2.887250286 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Myopathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.71E-06; Fold-change: 1.516320828; Z-score: 6.837750911 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.