Antigen Information
General Information of This Antigen
| Antigen ID | TAR0HELFC |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Delta-like protein 3 (DLL3) |
|||||
| Gene Name | DLL3 |
|||||
| Gene ID | ||||||
| Synonym | Drosophila Delta homolog 3 |
|||||
| Sequence |
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA GQRQHLLFPYPSSILSVK Click to Show/Hide
|
|||||
| Function |
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Rovalpituzumab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Rovalpituzumab tesirine |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Cit-PABC |
[1] | |
SC-002 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Vali-Ala dipeptide linker |
[2] |
SC16.10
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.10-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.10-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.10-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.10-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.10-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.101
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.101-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.101-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.101-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.101-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.101-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.103
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.103-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.103-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.103-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.103-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.103-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.104
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.104-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.104-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.104-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.104-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.104-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.105
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.105-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.105-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.105-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.105-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.105-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.106
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.106-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.106-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.106-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.106-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.106-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.107
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.107-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.107-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.107-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.107-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.107-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.108
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.108-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.108-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.108-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.108-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.108-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.109
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.109-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.109-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.109-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.109-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.109-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.11
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.11-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.11-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.11-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.11-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.11-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.110
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.110-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.110-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.110-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.110-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.110-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.111
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.111-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.111-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.111-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.111-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.111-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.113
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.113-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.113-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.113-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.113-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.113-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.114
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.114-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.114-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.114-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.114-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.114-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.115
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.115-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.115-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.115-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.115-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.115-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.116
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.116-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.116-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.116-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.116-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.116-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.117
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.117-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.117-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.117-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.117-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.117-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.118
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.118-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.118-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.118-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.118-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.118-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.120
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.120-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.120-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.120-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.120-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.120-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.121
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.121-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.121-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.121-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.121-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.121-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.122
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.122-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.122-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.122-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.122-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.122-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.123
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.123-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.123-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.123-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.123-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.123-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.124
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.124-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.124-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.124-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.124-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.124-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.125
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.125-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.125-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.125-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.125-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.125-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.126
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.126-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.126-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.126-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.126-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.126-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.129
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.129-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.129-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.129-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.129-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.129-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.13
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.13-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.13-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.13-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.13-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.13-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.130
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.130-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.130-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.130-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.130-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.130-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.131
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.131-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.131-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.131-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.131-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.131-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.132
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.132-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.132-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.132-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.132-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.132-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.133
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.133-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.133-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.133-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.133-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.133-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.134
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.134-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.134-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.134-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.134-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.134-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.135
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.135-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.135-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.135-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.135-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.135-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.136
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.136-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.136-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.136-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.136-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.136-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.137
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.137-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.137-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.137-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.137-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.137-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.138
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.138-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.138-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.138-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.138-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.138-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.139
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.139-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.139-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.139-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.139-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.139-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.140
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.140-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.140-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.140-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.140-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.140-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.141
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.141-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.141-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.141-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.141-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.141-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.142
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.142-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.142-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.142-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.142-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.142-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.143
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.143-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.143-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.143-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.143-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.143-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.144
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.144-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.144-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.144-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.144-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.144-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.147
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.147-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.147-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.147-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.147-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.147-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.148
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.148-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.148-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.148-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.148-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.148-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.149
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.149-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.149-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.149-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.149-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.149-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.15
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.15-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.15-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.15-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.15-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.15-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.150
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.150-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.150-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.150-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.150-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.150-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.18
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.18-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.18-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.18-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.18-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.18-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.19
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.19-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.19-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.19-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.19-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.19-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.20
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.20-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.20-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.20-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.20-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.20-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.21
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.21-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.21-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.21-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.21-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.21-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.22
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.22-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.22-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.22-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.22-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.22-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.23
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.23-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.23-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.23-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.23-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.23-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.25
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.25-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.25-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.25-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.25-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.25-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.26
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.26-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.26-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.26-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.26-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.26-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.29
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.29-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.29-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.29-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.29-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.29-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.3
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.3-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.3-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.3-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.3-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.3-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.30
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.30-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.30-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.30-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.30-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.30-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.31
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.31-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.31-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.31-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.31-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.31-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.34
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.34-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.34-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.34-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.34-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.34-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.35
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.35-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.35-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.35-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.35-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.35-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.36
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.36-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.36-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.36-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.36-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.36-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.38
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.38-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.38-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.38-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.38-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.38-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.4
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.4-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.4-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.4-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.4-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.4-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.41
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.41-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.41-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.41-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.41-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.41-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.42
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.42-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.42-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.42-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.42-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.42-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.45
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.45-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.45-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.45-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.45-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.45-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.47
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.47-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.47-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.47-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.47-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.47-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.49
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.49-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.49-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.49-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.49-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.49-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.5
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.5-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.5-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.5-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.5-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.5-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.50
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.50-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.50-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.50-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.50-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.50-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.52
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.52-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.52-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.52-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.52-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.52-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.55
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.55-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.55-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.55-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.55-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.55-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.56
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.56-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.56-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.56-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.56-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.56-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.57
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.57-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.57-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.57-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.57-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.57-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.58
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.58-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.58-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.58-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.58-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.58-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.61
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.61-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.61-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.61-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.61-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.61-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.62
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.62-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.62-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.62-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.62-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.62-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.63
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.63-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.63-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.63-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.63-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.63-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.65
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.65-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.65-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.65-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.65-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.65-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.67
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.67-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.67-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.67-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.67-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.67-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.68
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.68-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.68-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.68-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.68-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.68-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.7
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.7-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.7-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.7-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.7-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.7-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.72
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.72-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.72-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.72-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.72-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.72-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.73
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.73-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.73-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.73-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.73-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.73-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.78
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.78-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.78-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.78-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.78-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.78-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.79
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.79-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.79-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.79-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.79-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.79-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.8
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.8-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.8-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.8-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.8-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.8-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.80
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.80-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.80-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.80-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.80-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.80-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.81
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.81-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.81-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.81-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.81-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.81-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.84
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.84-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.84-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.84-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.84-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.84-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
SC16.88
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SC16.88-DL1 |
SG2000 derivative PBD 1 |
Microtubule (MT) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.88-DL2 |
SG3312 |
Human Deoxyribonucleic acid (hDNA) |
Mc-Val-Ala |
[3] | |
SC16.88-DL3 |
SG2000 derivative PBD 3 |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG8-Val-Ala |
[3] | |
SC16.88-DL4 |
SG2219 |
Human Deoxyribonucleic acid (hDNA) |
Iodoacetamide-PEG4-Val-Ala-PABC |
[3] | |
SC16.88-DL5 |
SG3199 |
Human Deoxyribonucleic acid (hDNA) |
Mc-PEG8-Val-Ala-PABC |
[3] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ZL-1310 |
Undisclosed |
Undisclosed |
Undisclosed |
[4] | |
YL-212 |
Undisclosed |
Undisclosed |
Undisclosed |
[5] | |
Anti-DLL3 ADC (IntoCell/Y-Biologics) |
Undisclosed |
Undisclosed |
Undisclosed |
[6] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Bacterial infection [ICD-11: 1A00-1C4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Bacterial infection of gingival | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00183932; Fold-change: 0.096573749; Z-score: 0.503935458 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
Brain cancer [ICD-11: 2A00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Brainstem | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002970929; Fold-change: 0.172024795; Z-score: 3.824899305 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008292948; Fold-change: 0.564008112; Z-score: 1.64718809 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem | |
| The Specific Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.52549365; Fold-change: -0.072141744; Z-score: -0.383717896 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Nervous | |
| The Specific Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.25E-37; Fold-change: 0.088039334; Z-score: 0.456616091 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic myeloid leukemia [ICD-11: 2A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Polycythemia vera | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.287799982; Fold-change: 0.020626332; Z-score: 0.160991328 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Whole blood | |
| The Specific Disease | Myelofibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.679253847; Fold-change: 0.027840503; Z-score: 0.214033687 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
MyeloDysplastic syndromes [ICD-11: 2A37]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myelodysplastic syndromes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.328560291; Fold-change: 0.033056318; Z-score: 0.173818069 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.034030842; Fold-change: -0.136344; Z-score: -1.892282987 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lymphoma [ICD-11: 2A90- 2A85]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Tonsil | |
| The Specific Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.189491122; Fold-change: -0.087631634; Z-score: -0.464692111 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Gastric cancer [ICD-11: 2B72]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric | |
| The Specific Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.451878732; Fold-change: -0.020318092; Z-score: -0.254753872 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.02569594; Fold-change: 0.164980448; Z-score: 0.777762472 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Colon cancer [ICD-11: 2B90]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon | |
| The Specific Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.35E-07; Fold-change: -0.082853737; Z-score: -0.415263417 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.18E-10; Fold-change: -0.130607819; Z-score: -0.595692834 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pancreatic cancer [ICD-11: 2C10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pancreas | |
| The Specific Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.01871017; Fold-change: -0.248076757; Z-score: -0.784498474 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.07E-08; Fold-change: -0.281389625; Z-score: -0.619644656 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Liver cancer [ICD-11: 2C12]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.07E-05; Fold-change: -0.210340909; Z-score: -0.936999571 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.72E-06; Fold-change: -0.095287968; Z-score: -0.444395745 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.925612874; Fold-change: 0.050933506; Z-score: 0.461460702 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lung cancer [ICD-11: 2C25]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.028293416; Fold-change: -0.003368926; Z-score: -0.017083688 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000168282; Fold-change: 0.029332803; Z-score: 0.122124898 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Melanoma [ICD-11: 2C30]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Melanoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.57E-05; Fold-change: 0.786306617; Z-score: 1.492617895 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sarcoma [ICD-11: 2C35]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Sarcoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.88E-19; Fold-change: -0.201347522; Z-score: -0.884686587 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.539959478; Fold-change: -0.028157039; Z-score: -0.326922127 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Breast cancer [ICD-11: 2C60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Breast | |
| The Specific Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.735600949; Fold-change: 0.004632054; Z-score: 0.022806768 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.522966528; Fold-change: 0.082412997; Z-score: 0.285954518 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ovarian cancer [ICD-11: 2C73]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Ovarian | |
| The Specific Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.698642956; Fold-change: 0.044142412; Z-score: 0.290642993 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.704928098; Fold-change: 0.01620659; Z-score: 0.067342466 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Cervical cancer [ICD-11: 2C77]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Cervical | |
| The Specific Disease | Cervical cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.757463385; Fold-change: -0.021925477; Z-score: -0.131626007 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Uterine cancer [ICD-11: 2C78]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Uterine cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034494854; Fold-change: 0.050106991; Z-score: 0.232886532 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.034418155; Fold-change: -0.200591948; Z-score: -1.053782727 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Prostate cancer [ICD-11: 2C82]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Prostate | |
| The Specific Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.473095076; Fold-change: -0.272117218; Z-score: -0.544007249 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Bladder cancer [ICD-11: 2C94]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.89E-05; Fold-change: 0.396816257; Z-score: 2.675515248 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Retina cancer [ICD-11: 2D02]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Uvea | |
| The Specific Disease | Retinoblastoma tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.471427749; Fold-change: -0.039557306; Z-score: -0.440469538 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Thyroid cancer [ICD-11: 2D10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Thyroid | |
| The Specific Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003434212; Fold-change: 0.07099326; Z-score: 0.39915997 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.160827549; Fold-change: 0.016787197; Z-score: 0.105467788 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Adrenal cancer [ICD-11: 2D11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adrenal cortex | |
| The Specific Disease | Adrenocortical carcinoma | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.034579294; Fold-change: -0.178680453; Z-score: -0.772132112 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Head and neck cancer [ICD-11: 2D42]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Head and neck | |
| The Specific Disease | Head and neck cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003343029; Fold-change: 0.08852457; Z-score: 0.534272734 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pituitary cancer [ICD-11: 2F37]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary gonadotrope tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.161980992; Fold-change: 0.058901014; Z-score: 0.42111394 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.573088599; Fold-change: 0.157878059; Z-score: 0.694859786 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
Thrombocytopenia [ICD-11: 3B64]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.967582032; Fold-change: 0.140315171; Z-score: 0.456593292 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
Lupus erythematosus [ICD-11: 4A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Lupus erythematosus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.153868637; Fold-change: 0.007578248; Z-score: 0.028353467 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Autoimmune disease [ICD-11: 4A4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral monocyte | |
| The Specific Disease | Autoimmune uveitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000129464; Fold-change: -0.319782849; Z-score: -3.171563971 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
Hyperlipoproteinaemia [ICD-11: 5C80]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000531087; Fold-change: -0.201256862; Z-score: -1.040587475 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
Schizophrenia [ICD-11: 6A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Superior temporal cortex | |
| The Specific Disease | Schizophrenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.679659454; Fold-change: -0.006150611; Z-score: -0.068467478 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
Multiple sclerosis [ICD-11: 8A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Spinal cord | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.110135611; Fold-change: -0.16182345; Z-score: -1.063816128 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Plasmacytoid dendritic cells | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.258531129; Fold-change: 0.08902371; Z-score: 0.406493087 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Epilepsy [ICD-11: 8A60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peritumoral cortex | |
| The Specific Disease | Epilepsy | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.13442071; Fold-change: 0.19467936; Z-score: 2.035528246 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Cerebral ischaemic stroke [ICD-11: 8B11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Cardioembolic Stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019674693; Fold-change: 0.096960103; Z-score: 0.492567573 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Ischemic stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.040323782; Fold-change: 0.075689861; Z-score: 0.629061018 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
HIV [ICD-11: 1C60-1C62]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | White matter | |
| The Specific Disease | HIV | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034159097; Fold-change: -0.083837355; Z-score: -0.410479014 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Influenza [ICD-11: 1E30]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Influenza | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.031710373; Fold-change: 0.199431795; Z-score: 2.237659527 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic hepatitis C [ICD-11: 1E51.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Chronic hepatitis C | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.941051692; Fold-change: 0.005648179; Z-score: 0.057525826 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sepsis [ICD-11: 1G40-1G41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Sepsis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.751375266; Fold-change: 0.010331439; Z-score: 0.033221948 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Septic shock [ICD-11: 1G41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Septic shock | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.446116457; Fold-change: 0.078779268; Z-score: 0.256608593 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Pediatric respiratory syncytial virus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.375769091; Fold-change: -0.029054199; Z-score: -0.362723703 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
Essential hypertension [ICD-11: BA00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Essential hypertension | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.914317521; Fold-change: -0.101427845; Z-score: -1.470046819 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myocardial infarction [ICD-11: BA41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myocardial infarction | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034263993; Fold-change: 0.109071706; Z-score: 0.401605645 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Coronary artery disease [ICD-11: BA8Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Coronary artery disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.141528843; Fold-change: -0.136318058; Z-score: -1.551278384 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Aortic stenosis [ICD-11: BB70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Calcified aortic valve | |
| The Specific Disease | Aortic stenosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.586600306; Fold-change: 0.087419201; Z-score: 0.22963864 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arteriosclerosis [ICD-11: BD40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arteriosclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.970004647; Fold-change: -0.054144005; Z-score: -0.246913438 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Aneurysm [ICD-11: BD50]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Intracranial artery | |
| The Specific Disease | Aneurysm | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.224573105; Fold-change: 0.068723246; Z-score: 0.532010227 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
Immunodeficiency [ICD-11: 4A00-4A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Immunodeficiency | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.19696785; Fold-change: 0.04806018; Z-score: 0.738085677 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Apnea [ICD-11: 7A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Hyperplastic tonsil | |
| The Specific Disease | Apnea | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.131051116; Fold-change: -0.089639648; Z-score: -0.960968521 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Olive pollen allergy [ICD-11: CA08.00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Olive pollen allergy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.11532062; Fold-change: 0.259271982; Z-score: 1.189168057 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic rhinosinusitis [ICD-11: CA0A]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Sinus mucosa | |
| The Specific Disease | Chronic rhinosinusitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.701312308; Fold-change: -0.067525475; Z-score: -0.621395106 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic obstructive pulmonary disease [ICD-11: CA22]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.535672872; Fold-change: 0.02237193; Z-score: 0.113918655 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Small airway epithelium | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000563028; Fold-change: 0.186487665; Z-score: 0.787947334 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Asthma [ICD-11: CA23]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal and bronchial airway | |
| The Specific Disease | Asthma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.987866123; Fold-change: -0.014756433; Z-score: -0.059502335 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Human rhinovirus infection [ICD-11: CA42]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal Epithelium | |
| The Specific Disease | Human rhinovirus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.411839429; Fold-change: 0.008681119; Z-score: 0.068680433 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Idiopathic pulmonary fibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.768573206; Fold-change: 0.054825988; Z-score: 0.206572866 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
Periodontal disease [ICD-11: DA0C]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Periodontal disease | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000273616; Fold-change: 0.1556295; Z-score: 0.71892813 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Eosinophilic gastritis [ICD-11: DA42.2]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric antrum | |
| The Specific Disease | Eosinophilic gastritis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.066158801; Fold-change: 0.135468006; Z-score: 1.466513642 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Liver failure [ICD-11: DB99.7-DB99.8]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver failure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.099851053; Fold-change: 0.054547372; Z-score: 0.728303361 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ulcerative colitis [ICD-11: DD71]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon mucosal | |
| The Specific Disease | Ulcerative colitis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.630794803; Fold-change: 0.026542583; Z-score: 0.113504866 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Irritable bowel syndrome [ICD-11: DD91.0]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Irritable bowel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.688873873; Fold-change: -0.015481788; Z-score: -0.092339128 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
Atopic dermatitis [ICD-11: EA80]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Atopic dermatitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001178261; Fold-change: -0.065485335; Z-score: -1.08430133 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Psoriasis [ICD-11: EA90]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Psoriasis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001662605; Fold-change: -0.109939913; Z-score: -0.358656807 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.95E-21; Fold-change: 0.457001086; Z-score: 1.67468064 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Vitiligo [ICD-11: ED63.0]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Vitiligo | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.368494637; Fold-change: -0.019749644; Z-score: -0.110188401 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Alopecia [ICD-11: ED70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin from scalp | |
| The Specific Disease | Alopecia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.1317621; Fold-change: 0.018937302; Z-score: 0.067151976 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sensitive skin [ICD-11: EK0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Sensitive skin | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.23905099; Fold-change: 0.135820869; Z-score: 1.260379446 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
Osteoarthritis [ICD-11: FA00-FA0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Osteoarthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.716160944; Fold-change: -0.004676848; Z-score: -0.019063897 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arthropathy [ICD-11: FA00-FA5Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthropathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.075041864; Fold-change: 0.047538421; Z-score: 0.363475615 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arthritis [ICD-11: FA20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.119904744; Fold-change: 0.055313821; Z-score: 0.162653169 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Rheumatoid arthritis [ICD-11: FA20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Rheumatoid arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019642973; Fold-change: -0.387187805; Z-score: -1.292062462 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ankylosing spondylitis [ICD-11: FA92.0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pheripheral blood | |
| The Specific Disease | Ankylosing spondylitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.422053865; Fold-change: -0.052149924; Z-score: -0.780913532 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Osteoporosis [ICD-11: FB83]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Osteoporosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.280336251; Fold-change: 0.102673162; Z-score: 0.721860156 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
Endometriosis [ICD-11: GA10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Endometriosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.133911489; Fold-change: 0.143032819; Z-score: 0.607841146 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Interstitial cystitis [ICD-11: GC00.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Interstitial cystitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.076519017; Fold-change: 0.105355022; Z-score: 1.424111186 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
Preterm birth [ICD-11: KA21.4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Myometrium | |
| The Specific Disease | Preterm birth | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.588831196; Fold-change: 0.041682777; Z-score: 0.212828356 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
Acute myelocytic leukemia [ICD-11: 2A60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Acute myelocytic leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000367815; Fold-change: 0.054325308; Z-score: 0.258741521 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myeloma [ICD-11: 2A83]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.840537113; Fold-change: 0.049051872; Z-score: 0.265286905 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.55799163; Fold-change: -0.013155143; Z-score: -0.059477664 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Oral cancer [ICD-11: 2B6E]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Oral | |
| The Specific Disease | Oral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.95E-06; Fold-change: -0.199596163; Z-score: -0.947846394 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000531862; Fold-change: 0.150607232; Z-score: 0.662319468 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Esophagal cancer [ICD-11: 2B70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Esophagus | |
| The Specific Disease | Esophagal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.202342513; Fold-change: 0.181618518; Z-score: 0.627607297 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Rectal cancer [ICD-11: 2B92]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Rectal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.097080582; Fold-change: -0.164113281; Z-score: -0.786242479 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.08E-05; Fold-change: -0.47849626; Z-score: -4.924300673 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Skin cancer [ICD-11: 2C30-2C3Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Skin cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000499269; Fold-change: 0.02893261; Z-score: 0.066154893 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.70E-65; Fold-change: 0.652889449; Z-score: 1.900474197 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Renal cancer [ICD-11: 2C90-2C91]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Kidney | |
| The Specific Disease | Renal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.180612425; Fold-change: -0.112988885; Z-score: -0.566072951 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.45E-13; Fold-change: -0.153741656; Z-score: -1.090458219 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ureter cancer [ICD-11: 2C92]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Urothelium | |
| The Specific Disease | Ureter cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.909447186; Fold-change: 0.043462863; Z-score: 0.205519415 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
Simpson golabi behmel syndrome [ICD-11: LD2C]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adipose | |
| The Specific Disease | Simpson golabi behmel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.769346608; Fold-change: 0.070792703; Z-score: 0.468757018 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Tuberous sclerosis complex [ICD-11: LD2D.2]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Perituberal | |
| The Specific Disease | Tuberous sclerosis complex | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.979730679; Fold-change: 0.171146885; Z-score: 1.24560427 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
Anemia [ICD-11: 3A00-3A9Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Anemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.748558569; Fold-change: 0.089668825; Z-score: 0.920221214 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Sickle cell disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.325154172; Fold-change: 0.096857242; Z-score: 0.549203226 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Thrombocythemia [ICD-11: 3B63]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocythemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.607707937; Fold-change: 0.013994817; Z-score: 0.11435878 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
Scleroderma [ICD-11: 4A42.Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Scleroderma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.463584202; Fold-change: -0.028732335; Z-score: -0.400989564 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sjogren syndrome [ICD-11: 4A43]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Salivary gland | |
| The Specific Disease | Sjogren syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.898501197; Fold-change: 0.044510972; Z-score: 0.309895391 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.010835796; Fold-change: -0.172196595; Z-score: -2.254852037 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Behcet disease [ICD-11: 4A62]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Behcet disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.963423816; Fold-change: -0.047471509; Z-score: -0.30526922 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Autosomal dominant monocytopenia [ICD-11: 4B04]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autosomal dominant monocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.69608877; Fold-change: 0.05103208; Z-score: 0.404304302 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
Type 2 diabetes [ICD-11: 5A11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.716016647; Fold-change: -0.053610778; Z-score: -0.414526024 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Polycystic ovary syndrome [ICD-11: 5A80.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Vastus lateralis muscle | |
| The Specific Disease | Polycystic ovary syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.5230718; Fold-change: -0.033968613; Z-score: -0.172564987 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Obesity [ICD-11: 5B81]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Subcutaneous Adipose | |
| The Specific Disease | Obesity | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.384438857; Fold-change: 0.0049627; Z-score: 0.043915236 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pompe disease [ICD-11: 5C51.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Biceps muscle | |
| The Specific Disease | Pompe disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.054159646; Fold-change: -0.066080674; Z-score: -0.804258743 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Batten disease [ICD-11: 5C56.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Batten disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.372696644; Fold-change: 0.042664355; Z-score: 0.899593811 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
Autism [ICD-11: 6A02]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autism | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.305534719; Fold-change: -0.04853849; Z-score: -0.193576724 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Anxiety disorder [ICD-11: 6B00-6B0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Anxiety disorder | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.247644743; Fold-change: 0.035959035; Z-score: 0.196929629 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
Parkinson disease [ICD-11: 8A00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Substantia nigra | |
| The Specific Disease | Parkinson disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.935488501; Fold-change: 0.010017166; Z-score: 0.070715394 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Huntington disease [ICD-11: 8A01]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Huntington disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.292294262; Fold-change: 0.012506516; Z-score: 0.088717041 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Alzheimer disease [ICD-11: 8A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Entorhinal cortex | |
| The Specific Disease | Alzheimer disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.009903982; Fold-change: -0.050227585; Z-score: -0.365833753 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Seizure [ICD-11: 8A60-8A6Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Seizure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.236061641; Fold-change: 0.047101488; Z-score: 0.348455839 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lateral sclerosis [ICD-11: 8B60.4]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.764838466; Fold-change: 0.132700345; Z-score: 0.559125407 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Cervical spinal cord | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.457997967; Fold-change: 0.078104102; Z-score: 0.404911992 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Muscular atrophy [ICD-11: 8C70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Muscular atrophy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.48E-05; Fold-change: -0.353834107; Z-score: -1.68064327 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myopathy [ICD-11: 8C70.6]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Myopathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012792673; Fold-change: -0.222357318; Z-score: -1.38267104 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.